DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD200R1L and Fas3

DIOPT Version :10

Sequence 1:NP_001008784.2 Gene:CD200R1L / 344807 HGNCID:24665 Length:271 Species:Homo sapiens
Sequence 2:NP_001097174.1 Gene:Fas3 / 35097 FlyBaseID:FBgn0000636 Length:577 Species:Drosophila melanogaster


Alignment Length:206 Identity:46/206 - (22%)
Similarity:78/206 - (37%) Gaps:49/206 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    85 TNETKETNCTVERITW-VSRPDQNSDLQIR--------PVDTTHDGYYRGI----VVTPDGNFHR 136
            ||:..|.:.:|:.|.| :|..|.|..|..|        .|......|...:    |..||...:.
  Fly   183 TNDNVELSTSVQEIQWHLSPEDSNRKLVCRSHHQTDRESVPPQEAAYIINVRYAPVHQPDAAVYG 247

Human   137 GY--HLQVLVTPEVNLFQSRNITAVCKAVTGKPAAQISWIPEGSIL----------ATKQEYWGN 189
            .|  |..::           |||     :...|..:|.|..:|:|:          |.:.:|.||
  Fly   248 LYLEHTAIV-----------NIT-----IRASPQPKIEWTIDGAIVGQGRTDGRYSAYEPQYLGN 296

Human   190 GTVTVKSTCPWEGHKSTVTCHVSHLTGNKSL-----SVKLNSGLRTSGSPALSLLIILYVKLSLF 249
            ....|  |....|.....|..:.:|..:..|     .|:::|..:...| :|.:..|:.:.:::.
  Fly   297 DEYNV--TLAIAGLTLEDTTKIYNLRASNELGLTDYQVRISSSSKPPSS-SLDVAAIVGIVVAVA 358

Human   250 VVILVTTGFVF 260
            |::||....||
  Fly   359 VLVLVVLLIVF 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD200R1LNP_001008784.2 Ig 37..143 CDD:472250 18/72 (25%)
Ig strand B 50..54 CDD:409353
Ig strand C 64..68 CDD:409353
Ig strand E 108..112 CDD:409353 1/3 (33%)
Ig strand F 122..127 CDD:409353 1/8 (13%)
Ig strand G 135..138 CDD:409353 0/2 (0%)
Ig 147..224 CDD:472250 19/91 (21%)
Ig strand B 156..160 CDD:409500 2/3 (67%)
Ig strand C 170..174 CDD:409500 1/3 (33%)
Ig strand F 206..211 CDD:409500 1/4 (25%)
Ig strand G 219..222 CDD:409500 1/7 (14%)
Fas3NP_001097174.1 C2-set_2 141..222 CDD:400489 11/38 (29%)
Ig strand B 146..150 CDD:409353
Ig strand C 160..164 CDD:409353
Ig strand E 194..198 CDD:409353 1/3 (33%)
Ig strand F 208..213 CDD:409353 1/4 (25%)
Ig strand G 226..229 CDD:409353 0/2 (0%)
Ig 253..326 CDD:472250 17/90 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.