DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD200R1L and orion

DIOPT Version :10

Sequence 1:NP_001008784.2 Gene:CD200R1L / 344807 HGNCID:24665 Length:271 Species:Homo sapiens
Sequence 2:NP_572427.1 Gene:orion / 31712 FlyBaseID:FBgn0027280 Length:664 Species:Drosophila melanogaster


Alignment Length:66 Identity:18/66 - (27%)
Similarity:25/66 - (37%) Gaps:17/66 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    74 QPSCT-KAYKKETNETKETNCT-VERITWVSRPDQNSDLQIRPVDTTHDGYYRGIVVTPDGNFHR 136
            ||.|: :.|          ||. |:...||....|||..:...::     |..|.|:...|...|
  Fly   342 QPKCSGRLY----------NCRFVDSDMWVCPSPQNSTRRYEFIE-----YENGRVLGQRGKCTR 391

Human   137 G 137
            |
  Fly   392 G 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD200R1LNP_001008784.2 Ig 37..143 CDD:472250 18/66 (27%)
Ig strand B 50..54 CDD:409353
Ig strand C 64..68 CDD:409353
Ig strand E 108..112 CDD:409353 1/3 (33%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 135..138 CDD:409353 2/3 (67%)
Ig 147..224 CDD:472250
Ig strand B 156..160 CDD:409500
Ig strand C 170..174 CDD:409500
Ig strand F 206..211 CDD:409500
Ig strand G 219..222 CDD:409500
orionNP_572427.1 DUF4803 202..456 CDD:465000 18/66 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.