DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD200R1L and igcm-1

DIOPT Version :10

Sequence 1:NP_001008784.2 Gene:CD200R1L / 344807 HGNCID:24665 Length:271 Species:Homo sapiens
Sequence 2:NP_508166.1 Gene:igcm-1 / 180433 WormBaseID:WBGene00018215 Length:1073 Species:Caenorhabditis elegans


Alignment Length:279 Identity:60/279 - (21%)
Similarity:107/279 - (38%) Gaps:79/279 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    22 MGGKQM-------------TQNYSTIFAEGNISQPVLM---DINAVLCC---PPIALRNLIIITW 67
            ||||::             :.:.|.:|.:...|:|..:   :...|:.|   |....|....|.|
 Worm     1 MGGKRLFFLFFLFLVQLTNSADSSDVFLKEPSSEPYFLQEGNEGIVIPCVVKPEYFDRQKYEINW 65

Human    68 EIILRGQ-PSCTK----AYKKET-----NETKETNCTVERITWVSRPD------------QNSDL 110
            .....|| ...||    ..||.:     |::...|.:: |||.|.:..            .:||:
 Worm    66 ARYNNGQLRMITKNDKLLAKKHSRFILENDSATGNYSL-RITEVEKNSVEGTYHCNVIGTDDSDV 129

Human   111 QIRPVDTTHDGYYRGIVVTPDGNFHRGYHLQVLVTPEVNLFQSRNITAVCKAVTGKPAAQISW-I 174
            |...:.|.       :|:.|.|:      ..:..||..::.:...:||.|.:|.|.|....:| :
 Worm   130 QYSALATV-------VVLVPPGD------PIISTTPSESVIEGDFMTAKCVSVGGSPQPTFTWTL 181

Human   175 PEGSILAT---KQEYWGNGTVTV---KSTCPWEGHKSTVTCHVSH--LTGNKSLSVKLNSGLRTS 231
            |..:|.::   ..::....|.::   :.|...:|  .:|.|.|::  :.|.::..||        
 Worm   182 PNDTIASSAIFTTQFRDGATESLLHFRVTSSDDG--KSVQCDVTNRAMLGGETKQVK-------- 236

Human   232 GSPALSLLIILYVKLSLFV 250
                .|.|.:|| |..:||
 Worm   237 ----SSQLNVLY-KPVVFV 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD200R1LNP_001008784.2 Ig 37..143 CDD:472250 27/133 (20%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 64..68 CDD:409353 1/3 (33%)
Ig strand E 108..112 CDD:409353 2/3 (67%)
Ig strand F 122..127 CDD:409353 0/4 (0%)
Ig strand G 135..138 CDD:409353 0/2 (0%)
Ig 147..224 CDD:472250 17/85 (20%)
Ig strand B 156..160 CDD:409500 2/3 (67%)
Ig strand C 170..174 CDD:409500 1/4 (25%)
Ig strand F 206..211 CDD:409500 2/4 (50%)
Ig strand G 219..222 CDD:409500 0/2 (0%)
igcm-1NP_508166.1 Ig 140..235 CDD:472250 20/102 (20%)
Ig strand B 162..166 CDD:409418 2/3 (67%)
Ig strand C 176..181 CDD:409418 1/4 (25%)
Ig strand E 203..207 CDD:409418 0/3 (0%)
Ig strand F 217..222 CDD:409418 2/4 (50%)
Ig strand G 231..234 CDD:409418 0/2 (0%)
Ig_3 245..316 CDD:464046 3/6 (50%)
Ig_3 333..398 CDD:464046
IG_like 437..513 CDD:214653
Ig strand B 443..447 CDD:409353
Ig strand C 458..461 CDD:409353
Ig strand E 478..482 CDD:409353
Ig strand F 492..497 CDD:409353
Ig 538..617 CDD:409353
Ig strand C 549..553 CDD:409353
Ig strand E 586..590 CDD:409353
Ig strand F 601..606 CDD:409353
Ig 642..727 CDD:472250
Ig strand B 650..654 CDD:409353
Ig strand C 663..667 CDD:409353
Ig strand E 688..699 CDD:409353
Ig strand F 709..714 CDD:409353
FN3 733..843 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.