DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31872 and AT1G73750

Sequence 1:NP_001285806.1 Gene:CG31872 FlyBaseID:FBgn0051872 Length:1073 Species:Drosophila melanogaster
Sequence 2:NP_001323220.1 Gene:AT1G73750 AraportID:AT1G73750 Length:468 Species:Arabidopsis thaliana

Alignment Length:191 Identity:43/192 (22%)
Similarity:70/192 (36%) Gaps:65/192 (34%)


  Fly   728 ETHYAFTADG-YKLCLHR-IPRSGAT----PVLLVHGLMASSDTWVQFGPSQGLAYILSQSGYDV 786
            |.||....:. :::.|.| :|...|.    |:||:.|:..::.|: ...|....|..:|.||:|.
plant    61 ELHYVPVPNSDWRVALWRYLPSPKAPKRNHPLLLLSGIGTNAVTY-DLSPECSFARSMSGSGFDT 124

  Fly   787 WMLNTRG-------------------------------------NVYS--------EERLAGRES 806
            |:|..||                                     ||..        ::||:.|..
plant   125 WILELRGAGLSSLSVDTNLGKGNNQQRIVSNLLENFISVSERLENVLDGGSKILGMQDRLSKRAG 189

  Fly   807 D---------KIFWDFSFHEIGQYDLPAAIDLILLQTKMP--SIQYIGHSQGSTAFFVMCS 856
            |         ...|||..:.  :.|:|:|:|.:..|||..  .:..:|||.|....:.:.|
plant   190 DFKQRFELIPHYNWDFDNYL--EEDVPSAMDYVRTQTKSKDGKLLAVGHSMGGILLYALLS 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31872NP_001285806.1 Abhydro_lipase 716..767 CDD:282003 12/45 (27%)
Abhydrolase_5 752..>894 CDD:289465 36/162 (22%)
AT1G73750NP_001323220.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11005
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.