DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31872 and abhd8a

Sequence 1:NP_001285806.1 Gene:CG31872 FlyBaseID:FBgn0051872 Length:1073 Species:Drosophila melanogaster
Sequence 2:XP_017207935.1 Gene:abhd8a ZFINID:ZDB-GENE-080204-70 Length:452 Species:Danio rerio

Alignment Length:357 Identity:65/358 (18%)
Similarity:114/358 (32%) Gaps:107/358 (30%)


  Fly   663 SQLQSQRQDQDQGPKFDDDLDEQPAPRSCSQCQKASYPQYITEVDIEIDAKLDTPKMISKYGHQA 727
            |.::.:..|....|...|.....|.|  .|..||.:.|........:....:||.:.||..   .
Zfish   108 STVEVELSDYTTAPSSPDPKTNPPLP--VSDQQKPAPPPRRRRRRPKRRVLIDTERSISSC---K 167

  Fly   728 ETHYAFTADGYKLCLHRIPRSGATPVLLVHGLMASSDTW---VQFGPSQGLAYILSQSGYDVWML 789
            .||                  ....:..:||:..|.|.|   :.|         .|:.||:|...
Zfish   168 GTH------------------SDVALFFIHGVGGSLDIWGSQLDF---------FSRLGYEVIAP 205

  Fly   790 NTRGNVYSEERLAGRESDKIFWDFSFHEIGQYDLPAAIDLILLQTKMPSIQYIGHSQGSTAFFVM 854
            :..|:       ....:.:|...::|:.:.: ||.|.......:..:    .||||.|.:....:
Zfish   206 DLAGH-------GASTAPQIAAAYTFYALAE-DLRAIFKRYARKRNI----LIGHSYGVSFCTFL 258

  Fly   855 CSERPEYAGKISLMQSLSPSVYMEGTRSPALKFMKVLQGGFTMLLNLLGGHKISLKNRIVDMFRN 919
            ..|.||...|:.::....|:.                                            
Zfish   259 AHEYPEQVHKVVMINGGGPTA-------------------------------------------- 279

  Fly   920 HICNKLIPSRICAIFEFVVCGFNFNSFNMTLSPILEGHASQGSSAKQIYHFAQLQGNSAFQKYDY 984
                 |.|| :|:||:...|..:..|..:..|.:..|.|.||:..||:     |:..:||....:
Zfish   280 -----LEPS-LCSIFQLPSCVLHCLSPCLAWSFLKAGFARQGAKEKQL-----LKEGNAFNVSPF 333

  Fly   985 GLILNKIRYQSIFP---PLYNLSLALGKVALH 1013
              :|..:.....:|   .:|:..|.:..:.:|
Zfish   334 --VLRAMMSGQYWPEGDEVYHAELTVPILLVH 363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31872NP_001285806.1 Abhydro_lipase 716..767 CDD:282003 10/54 (19%)
Abhydrolase_5 752..>894 CDD:289465 26/145 (18%)
abhd8aXP_017207935.1 Abhydrolase_5 174..395 CDD:289465 49/269 (18%)
MhpC 175..413 CDD:223669 49/268 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.