DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31872 and Abhd4

Sequence 1:NP_001285806.1 Gene:CG31872 FlyBaseID:FBgn0051872 Length:1073 Species:Drosophila melanogaster
Sequence 2:NP_001102336.1 Gene:Abhd4 RGDID:1311858 Length:355 Species:Rattus norvegicus

Alignment Length:446 Identity:85/447 (19%)
Similarity:150/447 (34%) Gaps:161/447 (36%)


  Fly   680 DDLDEQP-----------APRSCSQCQKASYPQYITEVDIEIDAKLDTPKMISKYGHQAETHYAF 733
            |||::||           .|.|.||         :..|:..|...|.. |.:::|......:..:
  Rat    16 DDLEQQPQGWLSSWLPTWRPTSMSQ---------LKNVEARILQCLQN-KFLARYVSLPNQNKIW 70

  Fly   734 TADGYKLCLHRIPRSGATPVLLVHGLMASSDTWVQFGPSQGLAYILSQSGYDVWMLN-----TRG 793
            |.....      .:...||:::|||          ||...||           |:||     .|.
  Rat    71 TVTVSP------EQKDRTPLVMVHG----------FGGGVGL-----------WILNMDSLSARR 108

  Fly   794 NVYSEERLA-GRESDKIFWDFSFHEIGQYDLPAAIDLILLQTK-------MPSIQYIGHSQG--- 847
            .:::.:.|. ||.|...|         ..|...|.|..:...:       :|::..:|||.|   
  Rat   109 TLHTFDLLGFGRSSRPTF---------PRDPEGAEDEFVTSIETWRETMGIPTMILLGHSLGGFL 164

  Fly   848 STAFFVMCSERPEYAGKISLM-------------QSLSPSVYMEGT-----RSPALKFMKVLQGG 894
            :|::.:...||.::   :.|:             :..:|..:::..     ||..|..::| .|.
  Rat   165 ATSYSIKYPERVKH---LILVDPWGFPLRPTDPSEIRTPPTWVKAVASVLGRSNPLAVLRV-AGP 225

  Fly   895 FTMLLNLLGGHKISLKNRIVDMFRN-------HICNKLIPSRICAIFEFVVCGFNFNSFNMTLSP 952
            :..  .|:...:...|.:..|.|.:       :.||...||...| |:.::     .||.....|
  Rat   226 WGP--GLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNPSGETA-FKAMM-----ESFGWARRP 282

  Fly   953 ILEGHASQGSSAKQIYHFAQLQGNSAFQKYDYGLILNKIRYQSIFPPLYNLSLALGKVALHRGDG 1017
            :||          :|:                 ||...:....|:                 |..
  Rat   283 MLE----------RIH-----------------LIRKDVPITMIY-----------------GAN 303

  Fly  1018 DWLG-SESDVLRLERDLPNCIENRNIRFEGFSHFDFTISKDVRSLVYDRVIDLCGS 1072
            .|:. |....::|:|  |:... |::..||.||..:.....:.:.|   |.::|.|
  Rat   304 TWIDTSTGKKVKLQR--PDSYV-RDMEIEGASHHVYADQPHIFNAV---VEEICNS 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31872NP_001285806.1 Abhydro_lipase 716..767 CDD:282003 8/51 (16%)
Abhydrolase_5 752..>894 CDD:289465 35/176 (20%)
Abhd4NP_001102336.1 Abhydrolase 67..>182 CDD:304388 31/154 (20%)
MhpC 80..349 CDD:223669 68/361 (19%)
Abhydrolase <154..224 CDD:304388 13/74 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.