DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31872 and CG3635

Sequence 1:NP_001285806.1 Gene:CG31872 FlyBaseID:FBgn0051872 Length:1073 Species:Drosophila melanogaster
Sequence 2:NP_610138.4 Gene:CG3635 FlyBaseID:FBgn0032981 Length:425 Species:Drosophila melanogaster

Alignment Length:375 Identity:121/376 (32%)
Similarity:192/376 (51%) Gaps:24/376 (6%)


  Fly   710 IDAKLDTPKMISKYGHQAETHYAFTADGYKLCLHRIP---------RSGATPVL-LVHGLMASSD 764
            :|....|...||.:.:..|.|...|.|.|.|.::|||         |:|...|: |.||::::||
  Fly    45 VDGHKVTATSISNHNYPVEEHTVITHDDYILTIYRIPSSPNRSHLNRAGRRAVVFLQHGILSASD 109

  Fly   765 TWVQFGPSQGLAYILSQSGYDVWMLNTRGNVYSEERLAGRESDKIFWDFSFHEIGQYDLPAAIDL 829
            .|:..||...|||:|:.:|||||:.|.|||.||.:..........||.||:||||.|||.|.:|.
  Fly   110 DWIINGPEASLAYMLADAGYDVWLGNARGNTYSRQHKHIHPDTSDFWRFSWHEIGVYDLAAMLDY 174

  Fly   830 ILLQTKMPSIQYIGHSQGSTAFFVMCSERPEYAGKISLMQSLSPSVYMEGTRSPALKFMKVLQGG 894
            .|.:::..|:.::.||||:|||||:.|..|.|..|:..:..|:|..||........|...:..|.
  Fly   175 ALAKSQSSSLHFVAHSQGTTAFFVLMSSLPLYNEKLRSVHLLAPIAYMRDHSFILSKLGGIFLGT 239

  Fly   895 FTMLLNLLGGHKISLKNRIVDMFRNHICNKLIPSRICAIFEFV-------VCGFNFNSFNMTLSP 952
            .:.|..:||..::.....:..:...|||:.      .::|.|:       :.|:.....|.||.|
  Fly   240 PSFLSWVLGSMELLPITNLQKLICEHICSS------SSMFNFLCSGLLDFIGGWGTRHLNQTLLP 298

  Fly   953 ILEGHASQGSSAKQIYHFAQLQGNSAFQKYDYGLILNKIRYQSIFPPLYNLSLALGKVALHRGDG 1017
            .:......|:|:.|:.|:.||..:..|::||:|..||:|.||...||.||:......|.::..:.
  Fly   299 DVCATHPAGASSSQVIHYLQLYRSGDFRQYDHGPELNEIIYQQPTPPSYNVQYIKSCVDMYYSEN 363

  Fly  1018 DWLGSESDVLRLERDLPNCIENRNIRFEGFSHFDFTISKDVRSLVYDRVI 1067
            |::.:..||..|...|| |.:...|.|..::|:||..|.:|:.::.:::|
  Fly   364 DYMSAVGDVKYLASLLP-CAQLYRIPFRDWNHYDFLWSNNVKEVINNKII 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31872NP_001285806.1 Abhydro_lipase 716..767 CDD:282003 21/61 (34%)
Abhydrolase_5 752..>894 CDD:289465 58/143 (41%)
CG3635NP_610138.4 Abhydro_lipase 55..115 CDD:282003 20/60 (33%)
Abhydrolase_1 97..399 CDD:278959 103/309 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93827637
eggNOG 1 0.900 E1_COG0596
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D408561at33208
OrthoFinder 1 1.000 FOG0000092
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11005
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.