DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31872 and mest

Sequence 1:NP_001285806.1 Gene:CG31872 FlyBaseID:FBgn0051872 Length:1073 Species:Drosophila melanogaster
Sequence 2:NP_571118.2 Gene:mest ZFINID:ZDB-GENE-991111-5 Length:344 Species:Danio rerio

Alignment Length:238 Identity:50/239 (21%)
Similarity:84/239 (35%) Gaps:82/239 (34%)


  Fly   749 GATPVL-LVHGLMASSDTWVQFGPSQGLAYILSQSGYDVW-MLNTRGNVYSEERLAGRESDKIFW 811
            |::.|| |:||...||..|                 |.:| .|..|.|     |:...:    |.
Zfish    76 GSSDVLVLLHGFPTSSYDW-----------------YKIWDSLTQRFN-----RVIALD----FL 114

  Fly   812 DFSF------HEIGQYDLPAAIDLIL--LQTKMPSIQYIGHSQGST-AFFVMCSERPEYAGKISL 867
            .|.|      |....::..:.::.::  |......|..:.|..|.| |..::.......:|.| :
Zfish   115 GFGFSDKPRPHRYSIFEQASVVEALVAHLGLSEQRINILSHDYGDTVALELLYRSDHNRSGHI-I 178

  Fly   868 MQSLSPS---VYMEGTRSPALKFM-KVLQ-GGF-----TMLLN----------LLGGHKISLKNR 912
            :.||..|   ::.| |..|  :|: |||: .||     |.|:|          :.|.:....:..
Zfish   179 VNSLCLSNGGIFPE-THHP--RFLQKVLKDSGFISPVLTRLMNFQLFSRGIKEVFGPYTQPTEAE 240

  Fly   913 IVDMFRNHICNKLIPSRICAIFEFVVCGFNFNSFNMTLSPILE 955
            :.||:                     .|..||..|:.:..:|:
Zfish   241 VWDMW---------------------TGIRFNDGNLVMDSLLQ 262

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31872NP_001285806.1 Abhydro_lipase 716..767 CDD:282003 9/19 (47%)
Abhydrolase_5 752..>894 CDD:289465 36/158 (23%)
mestNP_571118.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.