DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31872 and abhd-14

Sequence 1:NP_001285806.1 Gene:CG31872 FlyBaseID:FBgn0051872 Length:1073 Species:Drosophila melanogaster
Sequence 2:NP_500027.1 Gene:abhd-14 WormBaseID:WBGene00021927 Length:246 Species:Caenorhabditis elegans

Alignment Length:196 Identity:41/197 (21%)
Similarity:62/197 (31%) Gaps:47/197 (24%)


  Fly   729 THYAFTADGYKLCLHRIPRSGATPVLLVHGLMASSDTWVQFGPSQGLAYILSQSGYDVWMLN--- 790
            ||..|..:......|   .|.|| |:.:||...||.||.:    ..|....:..||....::   
 Worm    53 THSVFVREARPPGAH---YSKAT-VIFLHGQSFSSSTWTE----NNLLRTFAALGYRAIAIDLPG 109

  Fly   791 ---TRGNVYSEERLAGRESDKIFWDFSFHEIG-------------QYDLPAA-----IDLILLQT 834
               |||....:     .|......|| ...:|             ||.||..     :..::|..
 Worm   110 SGQTRGAAIPQ-----AEKPNFLMDF-IETLGLKQVMIVCASMAAQYVLPLMTSTRHLSCVVLVA 168

  Fly   835 KMPSIQYIGHSQGSTAFFVMCSERPEYAGKISLMQSLSPSVYMEGTRSPALKFMKVLQGGFTMLL 899
            ...:.:.:..|..:....|:..||.         .||.|:........|.:|..|:...|....|
 Worm   169 PSNTHEVVSPSSYTVPTLVVWGERD---------TSLGPTAAANLKNLPQVKLQKIPDAGHACYL 224

  Fly   900 N 900
            :
 Worm   225 H 225

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31872NP_001285806.1 Abhydro_lipase 716..767 CDD:282003 14/38 (37%)
Abhydrolase_5 752..>894 CDD:289465 32/166 (19%)
abhd-14NP_500027.1 MhpC 72..241 CDD:223669 35/175 (20%)
Abhydrolase_5 72..221 CDD:289465 34/169 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.