DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31872 and Ephx1

Sequence 1:NP_001285806.1 Gene:CG31872 FlyBaseID:FBgn0051872 Length:1073 Species:Drosophila melanogaster
Sequence 2:NP_034275.1 Gene:Ephx1 MGIID:95405 Length:455 Species:Mus musculus

Alignment Length:159 Identity:33/160 (21%)
Similarity:56/160 (35%) Gaps:65/160 (41%)


  Fly   933 IFEFVVCGFNFNSFNMTLSPILEGHA-SQGSSAKQIYHFAQLQGNSAFQKYDYGLILNKIRYQSI 996
            :|| |:|            |.:.|:. |:.||.|.                     ||.:....|
Mouse   177 VFE-VIC------------PSIPGYGFSEASSKKG---------------------LNSVATARI 207

  Fly   997 FPPLYNLSLALGKVALHRGDGDWLGSE--SDVLRLERDLPNCIE---------NRNI-------- 1042
            |   |.|...||....:...||| ||.  :::.::   :||.::         :|||        
Mouse   208 F---YKLMSRLGFQKFYIQGGDW-GSLICTNIAQM---VPNHVKGLHLNMSFISRNIYSLTPLLG 265

  Fly  1043 ----RFEGFSHFDFTISKDVRSLVYDRVI 1067
                ||.|::..|..:....:..|:..::
Mouse   266 QRFGRFLGYTEKDLELLYPFKEKVFYNIM 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31872NP_001285806.1 Abhydro_lipase 716..767 CDD:282003
Abhydrolase_5 752..>894 CDD:289465
Ephx1NP_034275.1 EHN 50..152 CDD:283978
MhpC 121..448 CDD:223669 33/160 (21%)
Abhydrolase 124..>255 CDD:304388 25/119 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.