DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myo31DF and ck

Sequence 1:NP_001188784.1 Gene:Myo31DF FlyBaseID:FBgn0086347 Length:1011 Species:Drosophila melanogaster
Sequence 2:NP_001285949.1 Gene:ck FlyBaseID:FBgn0000317 Length:2167 Species:Drosophila melanogaster

Alignment Length:840 Identity:305/841 (36%)
Similarity:459/841 (55%) Gaps:94/841 (11%)


  Fly     8 GVQDFVLLDQVSMEKFMDNLRKRFQNGSIYTYIGEVCVSMNPYRQMNIYGPETIRKYKGRELFEN 72
            ||:|.:.|..:.....:.||..|::...||||.|.:.|::|||:.:.||..:.|:.||.|::.|.
  Fly    64 GVEDMISLGDLHEAGILRNLLIRYKENLIYTYTGSILVAVNPYQILPIYTGDQIKLYKERKIGEL 128

  Fly    73 APHLFAIADSAYRVLKQRQQDTCILISGESGAGKTEASKIIMKYIAAVTNAQGQNEIERVKNVLI 137
            .||:|||.|:||..:|:.:||.||:|||||||||||::|:|::|:||::.....     ::..::
  Fly   129 PPHIFAIGDNAYAHMKRYRQDQCIVISGESGAGKTESTKLILQYLAAISGKHSW-----IEQQIL 188

  Fly   138 QSNAILETFGNAKTNRNDNSSRFGKYMDIEFDYKADPVGGIITNYLLEKSRVVQQQPGERNFHSF 202
            ::|.|||.||||||.|||||||||||:||.|.......|..|..|||||||:|.|...|||:|.|
  Fly   189 EANPILEAFGNAKTIRNDNSSRFGKYIDIHFSANGVIEGAKIEQYLLEKSRIVSQNHSERNYHVF 253

  Fly   203 YQLLRGANDNELRQYELQKETGKYHYLNQGS------MDILTEKSDYKGTCNAFKTLGFSTDEVQ 261
            |.:|.|.:.:|..:.:|.. ...|.||..|:      .|...|.||.:   :|.|.|.||..|:.
  Fly   254 YCILAGLSADEKSRLDLGM-AADYKYLTGGNSITCEGRDDAAEFSDIR---SAMKVLLFSDQEIW 314

  Fly   262 TIWRTIAAVLHLGNVEFQ-TIEDEL---VISNKQHLKSTAKLLQVTETELSTALTKRVIAAGGNV 322
            .|.:.:||:||.||:::: |:.|.|   .|....:::..|.||.:....|..|||:|.:.|.|..
  Fly   315 EIIKLLAALLHCGNIKYKATVVDNLDATEIPEHINVERVAGLLGLPIQPLIDALTRRTLFAHGET 379

  Fly   323 MQKDHNATQAEYGKDALAKAIYDRLFTWIISRINRAILFRGSKTQARFNSVIGVLDIYGFEIFDS 387
            :....:..|:...:||..|.||.|:|..|:.:||.||.    |.:....:.||||||:|||.||.
  Fly   380 VVSTLSRDQSVDVRDAFVKGIYGRMFVHIVRKINTAIF----KPRGTSRNAIGVLDIFGFENFDQ 440

  Fly   388 NSFEQFCINYCNEKLQQLFIELVLKQEQEEYQREGIEWTNIEYFNNKIICDLVEQPHKGIIAIMD 452
            ||||||||||.||.|||.|::.:.|.|||||..|.|.|.:||:.:|:...||:......|:|::|
  Fly   441 NSFEQFCINYANENLQQFFVQHIFKLEQEEYNHEAINWQHIEFVDNQDALDLIAIKQLNIMALID 505

  Fly   453 EACLSVGKVTDDTLLGAMDKNLSKHPHYTSRQLKPTDKELKHRED----FRITHYAGDVIYNING 513
            |.. ...|.||.|:|..:.|....|.:|           ||.:.|    |.:.|:||.|.|:..|
  Fly   506 EEA-RFPKGTDQTMLAKLHKTHGSHKNY-----------LKPKSDINTSFGLNHFAGVVFYDTRG 558

  Fly   514 FIEKNKDTLYQDFKRLLHNSKDANLSEMWPEGAQDIK---KTTKRPLTAGTLFQRSMADLVVTLL 575
            |::||:||...|...|:..|.:..|.:::   ||||:   :|.||..|..|.|::|:..|:.||.
  Fly   559 FLDKNRDTFSPDLLHLVSQSTNKFLRQIF---AQDIEMGAETRKRTPTLSTQFRKSLDALMKTLS 620

  Fly   576 KKEPFYVRCIKPNDLKSSTVFDEERVEHQVRYLGLLENLRVRRAGFVHRQRYDKFLLRYKMISQY 640
            ..:||::||||||:||...:||......|:||.|::|.:|:||||:..|..:.:|:.||:.:...
  Fly   621 SCQPFFIRCIKPNELKKPMMFDRGLCCRQLRYSGMMETIRIRRAGYPIRHGFREFVERYRFLIPG 685

  Fly   641 TWPNFR----AGSDRDGVRVLIEEKKFAQDVKYGHTKIFIRSPRTLFALEHQRNEMIPHIVTLLQ 701
            ..|..|    |.:.|....||.:     .|.:.||||:|::....|| ||.:|:.::...:.:||
  Fly   686 VPPAHRTDCQAATSRICAVVLGK-----SDYQLGHTKVFLKDAHDLF-LEQERDRVLTRKILILQ 744

  Fly   702 KRVRGWIVRRNFKKMK-AAITIVRAYKAY--------------KLRSYVQE--LANRLRKAKQMR 749
            :.:|||:.||.|.::: ||||:.|.:|.|              :|::.::.  |::|.|.     
  Fly   745 RSIRGWVYRRRFLRLRAAAITVQRFWKGYAQRKRYRNMRVGYMRLQALIRSRVLSHRFRH----- 804

  Fly   750 DYGKSIQWPQPPLAGRKVEAKLHRMFDFWRANMILHKYPRSEWPQLRLQIIAATALAGRR 809
                        |.|..|..:.|.     |..::..:|....|..:::|......:|.||
  Fly   805 ------------LRGHIVGLQAHA-----RGYLVRREYGHKMWAVIKIQSHVRRMIAMRR 847

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myo31DFNP_001188784.1 MYSc 6..690 CDD:214580 275/703 (39%)
MYSc_Myo1 21..677 CDD:276829 266/677 (39%)
Myosin_TH1 801..983 CDD:283635 3/10 (30%)
ckNP_001285949.1 MYSc 64..733 CDD:214580 275/703 (39%)
MYSc_Myo7 77..721 CDD:276832 266/677 (39%)
MyTH4 <1138..1245 CDD:214535
B41 1251..1467 CDD:214604
FERM_B-lobe 1355..1439 CDD:271216
FERM_C1_MyoVII 1461..1559 CDD:270019
SH3 1560..1624 CDD:302595
MyTH4 1701..1849 CDD:214535
B41 1856..2068 CDD:214604
FERM_M 1966..2068 CDD:278785
FERM_C2_MyoVII 2064..2159 CDD:270020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C103687543
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13140
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.