DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RluA-2 and RIB2

Sequence 1:NP_001188782.2 Gene:RluA-2 FlyBaseID:FBgn0032256 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_014575.1 Gene:RIB2 SGDID:S000005427 Length:591 Species:Saccharomyces cerevisiae

Alignment Length:512 Identity:179/513 (35%)
Similarity:262/513 (51%) Gaps:122/513 (24%)


  Fly    73 SEEKSETQSKEVLSEK---------RKASSTDDEGHVKKVK------LEANSLKTKRPGFSDERY 122
            |::.:...:||:.|.|         |..:..::...||...      ::.:..|||:   :|..|
Yeast     9 SDDFNNLLNKEIESAKEVKLRKFANRNNNRNENSSKVKDASGFRLRVIQTDGHKTKK---TDPDY 70

  Fly   123 DETSYYFENGLRKVYPYFFTFTTFAKGRWVDEKILDVFVREFRAAPPEEYERSLEAGKLTVNSEK 187
            :.|   .:..|||:.|||||:.||.|.||.|.|::||||.|||...|..|.:::..||:.:|.|.
Yeast    71 EVT---IDGPLRKIEPYFFTYKTFCKERWRDRKLVDVFVSEFRDREPSYYSKTIAEGKVYLNDEP 132

  Fly   188 VPKDYKIKHNDLLANVVHRHEVPVTSQPIKIVYMDKDIVVVNKPASIPVHPCGRYRHNTVVFILA 252
            ...|..|:..||:.:.|||||.||||:||.||:.|:||:|::||:||||||.||||.||:..:|.
Yeast   133 ANLDTIIRDGDLITHKVHRHEPPVTSKPIDIVFEDEDILVIDKPSSIPVHPTGRYRFNTITKMLE 197

  Fly   253 KEHNLKNLRTIHRLDRLTSGLLLFGRTAEKARELELQIRTRQVQKEYVCRVEGRFPDGIVECNEK 317
            ::... ::...:|||:.||||:...:|...|..:..|::.|:|.||||.||:|.||.||||.::.
Yeast   198 RQLGY-SVHPCNRLDKPTSGLMFLAKTPLGADRMGDQMKAREVTKEYVARVKGEFPIGIVEVDKP 261

  Fly   318 IDVVSYKI---GVCKVSPK-GKDCKTTFKRIGEVGSDSIVLCKPLTGRMHQIRVHLQFLGYPISN 378
            :..|:.|:   .||::|.: .|..||.|:|:...|..|||.|||||||.||||||||:||:||:|
Yeast   262 VRSVNPKVALNAVCEMSDENAKHAKTVFQRVSYDGQTSIVKCKPLTGRTHQIRVHLQYLGFPIAN 326

  Fly   379 DPLY-NHEVFGPLKGRGG-----DIGGITEEQLISNLISI---HNAENWL--GLEGDQIVSGEIK 432
            ||:| |.:::||..||||     ||        :..|.:|   :.||:|:  ..||:.::.    
Yeast   327 DPIYSNPDIWGPDLGRGGLQNYDDI--------VLKLDAIGKTNPAESWIHPHSEGEYLLG---- 379

  Fly   433 DVAASTSVVEAPSVVQAPINSETEKPVISKNLEPSNDATAQIATQTCYEEPDRSFDSKKTTSDPQ 497
                                                                           .|
Yeast   380 ---------------------------------------------------------------RQ 381

  Fly   498 CSECKIN-YRDPGTKDLIMYLHAWKYKGVG---------WEYETELPEWACNSNIDY 544
            |.||:.. |.||||.||.::|||::|:.:.         |.|.|:.||||...:..|
Yeast   382 CEECEAEMYTDPGTNDLDLWLHAFRYESLERNSDTQKPLWSYRTKYPEWALEPHRRY 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RluA-2NP_001188782.2 S4 157..229 CDD:238095 34/72 (47%)
PseudoU_synth_ScRIB2 202..386 CDD:211331 95/189 (50%)
RIB2NP_014575.1 rluA_subfam 94..406 CDD:161659 145/388 (37%)
PseudoU_synth_ScRIB2 146..431 CDD:211331 131/361 (36%)
RibD1 433..586 CDD:223195 1/7 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C250730598
eggNOG 1 0.900 E1_COG0564
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 307 1.000 Inparanoid score I478
Isobase 1 0.950 0 Normalized mean entropy S1507
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002458
OrthoInspector 1 1.000 T133867
orthoMCL 1 0.900 OOG5_126865
Panther 1 1.100 O PTHR21600
Phylome 1 0.910 0.872 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1681
TreeFam 1 0.960
1211.730

Return to query results.
Submit another query.