DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RluA-2 and RPUSD4

Sequence 1:NP_001188782.2 Gene:RluA-2 FlyBaseID:FBgn0032256 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_116184.2 Gene:RPUSD4 HGNCID:25898 Length:377 Species:Homo sapiens

Alignment Length:249 Identity:72/250 (29%)
Similarity:114/250 (46%) Gaps:45/250 (18%)


  Fly   196 HNDLLANVVHRHEVPVTSQPIKIVYMDKDIVVVNKPASIPVH--PCGRYRHNTVVFILAK---EH 255
            |.::||..:.|          .|::.||::||:|||..:|||  |..:.....|:.||||   .|
Human    87 HPNVLAKALTR----------GILHQDKNLVVINKPYGLPVHGGPGVQLCITDVLPILAKMLHGH 141

  Fly   256 NLKNLRTIHRLDRLTSGLLLFGRTAEKARELELQIRTRQVQKEY-VCRVEGRFPD-GIVECNEKI 318
            ..:.|...||||:.|:|:::.....:.|.:::...|||||.|:| ...|....|. |:|:    |
Human   142 KAEPLHLCHRLDKETTGVMVLAWDKDMAHQVQELFRTRQVVKKYWAITVHVPMPSAGVVD----I 202

  Fly   319 DVV-----------------SYKIGVCKV-----SPKGKDCKTTFKRIGEVGSDSIVLCKPLTGR 361
            .:|                 ||::...|:     |...:...|.::.:....|.::|..:|:||.
Human   203 PIVEKEAQGQQQHHKMTLSPSYRMDDGKMVKVRRSRNAQVAVTQYQVLSSTLSSALVELQPITGI 267

  Fly   362 MHQIRVHLQF-LGYPISNDPLYNH-EVFGPLKGRGGDIGGITEEQLISNLISIH 413
            .||:||||.| |..||..|..|:. ....|.|...|.:..:..||..:..|.:|
Human   268 KHQLRVHLSFGLDCPILGDHKYSDWNRLAPQKLSVGTLKKLGLEQSKARYIPLH 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RluA-2NP_001188782.2 S4 157..229 CDD:238095 9/33 (27%)
PseudoU_synth_ScRIB2 202..386 CDD:211331 62/215 (29%)
RPUSD4NP_116184.2 PseudoU_synth_RluCD_like 106..329 CDD:211346 65/221 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.