DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RluA-2 and Rpusd2

Sequence 1:NP_001188782.2 Gene:RluA-2 FlyBaseID:FBgn0032256 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_001129317.1 Gene:Rpusd2 RGDID:1306147 Length:553 Species:Rattus norvegicus

Alignment Length:552 Identity:229/553 (41%)
Similarity:323/553 (58%) Gaps:65/553 (12%)


  Fly     2 ESSKLLRNAQTQHGDASSVDVENIFLHRHMLYTNPTSDGNLHDREDSPECVWCPDDKDGSPAESK 66
            |::..|:....|:||..| |...   ..|:....|.:.|     :..||        .|..|:..
  Rat    44 EAADGLKALIEQNGDTGS-DTRG---EPHLELLEPATVG-----KQVPE--------SGEQAQGG 91

  Fly    67 DPPISISEEKSETQSKEVLSEKRKASSTDDEGHVKKVKLEANSLKTKRPG--FSDERYDETSYYF 129
            :..:..:.|::.|...:....|::..:|.:.        .....|.:|.|  ||||.:.||:|||
  Rat    92 EEQLPGNGEQAPTPVADSGKRKKRRGATGER--------VVPPPKKRRTGVSFSDEHFAETTYYF 148

  Fly   130 ENGLRKVYPYFFTFTTFAKGRWVDEKILDVFVREFRAAPPEEYERSLEAGKLTVNSEKVPKDYKI 194
            |.|||||.||:|.|.|:.|||||...:|.||..|||:.|...||.::.||:|.:|.|.| :|..|
  Rat   149 EGGLRKVRPYYFDFQTYCKGRWVGRSLLHVFSTEFRSQPLAYYEAAVRAGRLHLNEEPV-QDLNI 212

  Fly   195 --KHNDLLANVVHRHEVPVTSQPIKIVYMDKDIVVVNKPASIPVHPCGRYRHNTVVFILAKEHNL 257
              |.||.|.|.|||||.|||::||:::..:.|:||::||:|||||||||:|||||:|||.|||.|
  Rat   213 VLKDNDFLRNTVHRHEPPVTAEPIRLLAENDDVVVIDKPSSIPVHPCGRFRHNTVIFILGKEHQL 277

  Fly   258 KNLRTIHRLDRLTSGLLLFGRTAEKARELELQIRTRQVQKEYVCRVEGRFPDGIVECNEKIDVVS 322
            |.|..:|||||||||:|:|.:||..:.::..|:|.||::|||||||.|.|||..|.|.|.|.|||
  Rat   278 KELHPLHRLDRLTSGVLMFAKTAAVSEKIHEQVRDRQLEKEYVCRVAGEFPDKEVICKEPILVVS 342

  Fly   323 YKIGVCKVSPKGKDCKTTFKRIGEVGSDSIVLCKPLTGRMHQIRVHLQFLGYPISNDPLYNHEVF 387
            ||:|||:|.|:||.|:|.|:|:...|..|:|.|:|||||.|||||||||||:||.|||:||...:
  Rat   343 YKVGVCRVDPQGKPCETVFQRLSYNGRSSVVQCRPLTGRTHQIRVHLQFLGHPILNDPIYNSTAW 407

  Fly   388 GPLKGRGGDIGGITEEQLISNLISIHNAENWLGL----EGDQIVSGEIKDVAAST--------SV 440
            ||.:|:||.|.. |:|:|:.:|::.|.|:..|.:    ||| :..|.|...|.|:        .:
  Rat   408 GPSRGQGGHIPK-TDEELLRDLVAEHQAKESLSMLDLCEGD-LAPGLIDSTAPSSELGKDSLEGL 470

  Fly   441 VEAPSVVQAPINSETEKPVISKNLEPSNDATAQIATQTCYEEPDRSFDSKKTTSDPQCSECKINY 505
            ..|...:...::..::.|.     .|...|.|.::.||                ||.|:||::..
  Rat   471 ATAAQKIDGMVDEASQHPD-----TPGKAAKADVSQQT----------------DPLCAECRVLR 514

  Fly   506 RDPGTKDLIMYLHAWKYKGVGWEYETELPEWA 537
            :||..:||:|:|||.:|||..:||.:.:|.||
  Rat   515 QDPLPQDLVMFLHALRYKGPDFEYVSPIPAWA 546

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RluA-2NP_001188782.2 S4 157..229 CDD:238095 35/74 (47%)
PseudoU_synth_ScRIB2 202..386 CDD:211331 114/184 (62%)
Rpusd2NP_001129317.1 PseudoU_synth_ScRIB2 221..404 CDD:211331 114/183 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C250712858
eggNOG 1 0.900 E1_COG0564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002458
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21600
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.