DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RluA-2 and Rpusd2

DIOPT Version :8

Sequence 1:NP_001188782.2 Gene:RluA-2 / 34440 FlyBaseID:FBgn0032256 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_775626.1 Gene:Rpusd2 / 271842 MGIID:1918066 Length:553 Species:Mus musculus

Alignment Length:503 Identity:221/504 (44%)
Similarity:308/504 (61%) Gaps:46/504 (9%)


  Fly    60 GSPAESKDPPISISEEKSETQSKEVLSEKRKASSTD-------DEGHVKKVKLEANSL-----KT 112
            |.|...:..|.::.::..|:..:....|.:..|:.:       |.|..||.:......     |.
Mouse    65 GEPLLERLEPAAVGKQVPESGDQAQGGEGQLPSNGEQTPAPVADSGKRKKRRGATGERVVPPPKK 129

  Fly   113 KRPG--FSDERYDETSYYFENGLRKVYPYFFTFTTFAKGRWVDEKILDVFVREFRAAPPEEYERS 175
            :|.|  ||||.:.||:||||.|||||.||:|.|.|:.|||||...:|.||..|||:.|...||.:
Mouse   130 RRTGVSFSDEHFAETTYYFEGGLRKVRPYYFDFQTYCKGRWVGRSLLHVFSTEFRSQPLSYYEAA 194

  Fly   176 LEAGKLTVNSEKVPKDYKI--KHNDLLANVVHRHEVPVTSQPIKIVYMDKDIVVVNKPASIPVHP 238
            :.||:|.:|.|.| :|..|  |.||.|.|.|||||.|||::||.::..:.|:||::||:||||||
Mouse   195 VRAGRLHLNEEPV-QDLSIVLKDNDFLRNTVHRHEPPVTAEPIHLLAENNDVVVIDKPSSIPVHP 258

  Fly   239 CGRYRHNTVVFILAKEHNLKNLRTIHRLDRLTSGLLLFGRTAEKARELELQIRTRQVQKEYVCRV 303
            |||:|||||:|||.|||.||.|..:|||||||||:|:|.:||..:.::..|:|.||::|||||||
Mouse   259 CGRFRHNTVIFILGKEHQLKELHPLHRLDRLTSGVLMFAKTAAVSEKIHEQVRDRQLEKEYVCRV 323

  Fly   304 EGRFPDGIVECNEKIDVVSYKIGVCKVSPKGKDCKTTFKRIGEVGSDSIVLCKPLTGRMHQIRVH 368
            .|.|||..|.|.|.|.|||||:|||:|.|:||.|:|.|:|:...|..|:|.|:|||||.||||||
Mouse   324 AGEFPDKEVICKEPILVVSYKVGVCRVDPRGKPCETVFQRLSYNGRSSVVQCRPLTGRTHQIRVH 388

  Fly   369 LQFLGYPISNDPLYNHEVFGPLKGRGGDIGGITEEQLISNLISIHNAENWLGL----EGDQIVSG 429
            |||||:||.|||:||...:||.:|:||.|.. |:|:|:.:|::.|.|:..|.:    |.| :..|
Mouse   389 LQFLGHPILNDPIYNSTAWGPSRGQGGHIPK-TDEELLRDLVAEHQAKESLSMLDLCESD-LTPG 451

  Fly   430 EIKDVAASTSV----VEAPSVVQAPINSETEKPVISKNLE-PSNDATAQIATQTCYEEPDRSFDS 489
            .|...|.|:.:    :|..:.....|:...|  ...::|: |...|.|.:..:|           
Mouse   452 LIDSTAPSSELAKDSLEGLATAAQKIDGIAE--AAPQHLDTPEKAAKADVTQET----------- 503

  Fly   490 KKTTSDPQCSECKINYRDPGTKDLIMYLHAWKYKGVGWEYETELPEWA 537
                 ||.|:||::..:||..:||:|:|||.:|||..:||.:.:|.||
Mouse   504 -----DPLCAECRVLRQDPLPQDLVMFLHALRYKGPDFEYVSPIPAWA 546

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RluA-2NP_001188782.2 S4 157..229 CDD:238095 35/74 (47%)
PseudoU_synth_ScRIB2 202..386 CDD:211331 114/184 (62%)
Rpusd2NP_775626.1 Rox3 <4..150 CDD:285797 23/85 (27%)
PseudoU_synth_ScRIB2 221..404 CDD:211331 114/183 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C250711343
eggNOG 1 0.900 E1_COG0564
Hieranoid 1 1.000
Homologene 1 1.000 H5588
Inparanoid 1 1.050 420 1.000 Inparanoid score I1770
Isobase 1 0.950 0 Normalized mean entropy S1507
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002458
OrthoInspector 1 1.000 T616680
orthoMCL 1 0.900 OOG5_126865
Panther 1 1.100 O PTHR21600
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1681
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.