DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RluA-2 and SPAC18B11.02c

Sequence 1:NP_001188782.2 Gene:RluA-2 FlyBaseID:FBgn0032256 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_592881.1 Gene:SPAC18B11.02c PomBaseID:SPAC18B11.02c Length:394 Species:Schizosaccharomyces pombe

Alignment Length:429 Identity:161/430 (37%)
Similarity:241/430 (56%) Gaps:55/430 (13%)


  Fly   113 KRPGFSDERYDETSYYFE-NGLRKVYPYFFTFTTFAKGRWVDEKILDVFVREFRAAPPEEYERSL 176
            |||  ..:...:..|.|: :|||:|.||::.:.||||.||..:.:|:||..|||......||:::
pombe     3 KRP--KRDPLKDCEYVFKGDGLRRVPPYYYEYITFAKLRWYGKTLLEVFNTEFRDRESGYYEKAI 65

  Fly   177 EAGKLTVNSEKVPKDYKIKHNDLLANVVHRHEVPVTSQPIKIVYMDKDIVVVNKPASIPVHPCGR 241
            ..|::.||::....|..|::..::::..||||.||:.||:.||:.|:..||::|||.:||||.||
pombe    66 RNGQVKVNNQIGNVDTLIENGYIVSHHAHRHEPPVSDQPVGIVHEDESYVVIDKPAGVPVHPTGR 130

  Fly   242 YRHNTVVFILAKEHNLKNLRTIHRLDRLTSGLLLFGRTAEKARELELQIRTRQVQKEYVCRVEGR 306
            |.||||:.||.||:....|...:|||||||||:.|.::.:.|.|:.:.:.::.::||||.||.|.
pombe   131 YNHNTVLHILMKENKCSLLYPCNRLDRLTSGLMFFSKSPKAAEEMRVHMISKSLKKEYVARVIGE 195

  Fly   307 FPD-GIVECNEKIDVVSYKIGVCKVSPKGKDCKTTFKRIGEVGSDSIVLCKPLTGRMHQIRVHLQ 370
            ||: |.|.|:..:..|:..:|:.::.|.||:..|.||||...|..|:|||||||||.||:|||||
pombe   196 FPNSGEVICDAPLLTVAPTLGLNRIHPDGKEASTVFKRIAFDGHTSLVLCKPLTGRTHQLRVHLQ 260

  Fly   371 FLGYPISNDPLY-NHEVFGPLKGRGGDIGGITEEQLISNLISIHNAENWLGLEGDQIVSGEIKDV 434
            :|||||:|||:| |..|:||..|:.|:  | :.|.:|..|..|.                     
pombe   261 YLGYPIANDPIYANKRVWGPSLGKNGE--G-SNESVIMRLSEIG--------------------- 301

  Fly   435 AASTSVVEAPSVVQAPINSETEKPVISKNLEPSNDATAQIATQTCYEEPDRSFDSKKTTSDPQCS 499
                             .:||..|::..... :|:..|:...:.     |:......|  ...||
pombe   302 -----------------KTETASPLLQYEWY-TNETEAEAKARR-----DKRLGELLT--GKHCS 341

  Fly   500 ECKIN-YRDPGTKDLIMYLHAWKYKGVGWEYETELPEWA 537
            ||... |.||..::|.::|||.||:...|.|:|:||:||
pombe   342 ECGTPLYSDPSPEELGIWLHALKYESKDWSYKTQLPKWA 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RluA-2NP_001188782.2 S4 157..229 CDD:238095 26/72 (36%)
PseudoU_synth_ScRIB2 202..386 CDD:211331 94/186 (51%)
SPAC18B11.02cNP_592881.1 rluA_subfam 39..364 CDD:161659 137/374 (37%)
PseudoU_synth_ScRIB2 90..380 CDD:211331 130/339 (38%)
Auto_anti-p27 330..356 CDD:294466 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 272 1.000 Inparanoid score I690
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002458
OrthoInspector 1 1.000 T631716
orthoMCL 1 0.900 OOG5_126865
Panther 1 1.100 O PTHR21600
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1681
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.