DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RluA-2 and RPUSD1

Sequence 1:NP_001188782.2 Gene:RluA-2 FlyBaseID:FBgn0032256 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_001311015.1 Gene:RPUSD1 HGNCID:14173 Length:315 Species:Homo sapiens

Alignment Length:216 Identity:58/217 (27%)
Similarity:82/217 (38%) Gaps:48/217 (22%)


  Fly   210 PVTSQPIKIVYMDKDIVVVNKPASIPVHPCG-----------RYRHNTVVFILAKEHNLKNLRTI 263
            |.:.:.:.|||..:|.:||||...:.:....           |||...    ||........|..
Human     3 PGSVENLSIVYRSRDFLVVNKHWDVRIDSKAWRETLTLQKQLRYRFPE----LADPDTCYGFRFC 63

  Fly   264 HRLDRLTSGLLLFGRTAEKARELELQIRTRQVQKEYVCRVEGRFPDGIVECNEKIDVVSYKIG-- 326
            |:||..|||.|........|.......:.|:|.|.|:..:.|...:..|       .:|:.||  
Human    64 HQLDFSTSGALCVALNKAAAGSAYRCFKERRVTKAYLALLRGHIQESRV-------TISHAIGRN 121

  Fly   327 --------VCKVSPKG-KDCKTTFKRI--------GEVGSDSI--VLCKPLTGRMHQIRVHLQFL 372
                    :|....:| ..|:.....:        |....|.:  ||.||||||.||:|||...|
Human   122 STEGRAHTMCIEGSQGVAGCENPKPSLTDLVVLEHGLYAGDPVSKVLLKPLTGRTHQLRVHCSAL 186

  Fly   373 GYPISNDPLYNHEVFGPLKGR 393
            |:|:..|..|     |.:.||
Human   187 GHPVVGDLTY-----GEVSGR 202

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RluA-2NP_001188782.2 S4 157..229 CDD:238095 7/19 (37%)
PseudoU_synth_ScRIB2 202..386 CDD:211331 55/208 (26%)
RPUSD1NP_001311015.1 RluA <9..233 CDD:223638 57/211 (27%)
PseudoU_synth_RluCD_like 18..218 CDD:211346 53/202 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D504187at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.