DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RluA-2 and Rpusd1

Sequence 1:NP_001188782.2 Gene:RluA-2 FlyBaseID:FBgn0032256 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_082285.1 Gene:Rpusd1 MGIID:1919186 Length:306 Species:Mus musculus

Alignment Length:202 Identity:55/203 (27%)
Similarity:80/203 (39%) Gaps:40/203 (20%)


  Fly   210 PVTSQPIKIVYMDKDIVVVNKPASIPVHPCGRYRHNTVVFILAKEHNLKNL---------RTIHR 265
            |.:.:.:.|||...|.:||||...:.:.  .:....|:.......|:...|         |..|:
Mouse     3 PGSMENLSIVYQSSDFLVVNKHWDLRID--SKTWRETLTLQKQLRHHFPELADPDTCYGFRFCHQ 65

  Fly   266 LDRLTSGLLLFGRTAEKARELELQIRTRQVQKEYVCRVEGRFPDGIVECNEKIDVVSYKIGVCKV 330
            ||..|||.|........|.......:.|:|.|.|:..|.|...:..|       .::|.||  :.
Mouse    66 LDFSTSGALCVALNKAAAGSAYKCFKERRVTKAYLALVRGHVQESQV-------TINYAIG--RN 121

  Fly   331 SPKGK----------DCKTTFKRIGEV--------GSDSI--VLCKPLTGRMHQIRVHLQFLGYP 375
            |.:|:          .|:.....:.|:        ..|.:  ||.||||||.||:|||...||:|
Mouse   122 STEGRTHTMCIEGTHGCENPKPSLTELLVLEHGLYAGDPVSKVLLKPLTGRTHQLRVHCSALGHP 186

  Fly   376 ISNDPLY 382
            |..|..|
Mouse   187 IVGDLTY 193

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RluA-2NP_001188782.2 S4 157..229 CDD:238095 7/19 (37%)
PseudoU_synth_ScRIB2 202..386 CDD:211331 55/203 (27%)
Rpusd1NP_082285.1 RluA <9..230 CDD:223638 54/197 (27%)
PseudoU_synth_RluCD_like 18..215 CDD:211346 50/188 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D504187at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.