DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RluA-2 and rpusd3

Sequence 1:NP_001188782.2 Gene:RluA-2 FlyBaseID:FBgn0032256 Length:547 Species:Drosophila melanogaster
Sequence 2:XP_002933094.2 Gene:rpusd3 XenbaseID:XB-GENE-982810 Length:407 Species:Xenopus tropicalis

Alignment Length:267 Identity:53/268 (20%)
Similarity:105/268 (39%) Gaps:55/268 (21%)


  Fly   218 IVYMDKDIVVVNKPASIPVHPCGRYRHNTVVFILAK-EHNL---KNLRTIHRLDRLTSGLLLFGR 278
            :||:...:|.:|||..:.:  .|:.:..:|..:||. :.:|   .:|..:....:.:|||:|...
 Frog   126 VVYLKGPLVAINKPQGLSI--TGKEQEVSVSSLLADLQQHLGLGSDLHIVKAAPKESSGLVLLST 188

  Fly   279 TAEKARELE-LQIRTRQVQKEYV--CRVEGRFP---DGIVECNEKID-VVSYKIGVCKVSP-KG- 334
            .....:.|| .....|:.||...  |.|....|   :|.::...|:: :..:::.|....| || 
 Frog   189 CHMTTKRLEDYYALCRKAQKPTASYCAVMAGVPHPAEGEIKAALKLERIEDWQLVVPVTDPSKGR 253

  Fly   335 ------KDCKTTFKRIGEVGSDSIVLCKPLTGRMHQIRVHLQFLGYPISNDPLYN--------HE 385
                  |...|.:|.:......::|..:|::....|:.||...:...|..|..|:        ..
 Frog   254 LERREIKRTLTRYKVLDSADGCALVQLQPMSVFQAQLLVHSTLMFCRILGDHTYSARVGKVLGEN 318

  Fly   386 VFGPLKGRGGDIG----GITEEQLISNL---------ISIHNAENWLGLEGDQIVSGEIKDVAAS 437
            :|.|:     ||.    .:.||.::..:         :.:|.....|.:.|:....|:       
 Frog   319 IFVPM-----DIALPRTQVLEENVLRRMHFTQQQMHRMPLHLHFQQLMIPGESPAEGD------- 371

  Fly   438 TSVVEAP 444
             :.::||
 Frog   372 -TFLDAP 377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RluA-2NP_001188782.2 S4 157..229 CDD:238095 3/11 (27%)
PseudoU_synth_ScRIB2 202..386 CDD:211331 41/195 (21%)
rpusd3XP_002933094.2 PseudoU_synth_RluCD_like 133..316 CDD:211346 39/185 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.