DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LManII and MAN2B2

DIOPT Version :10

Sequence 1:NP_609408.1 Gene:LManII / 34437 FlyBaseID:FBgn0027611 Length:1080 Species:Drosophila melanogaster
Sequence 2:NP_056089.1 Gene:MAN2B2 / 23324 HGNCID:29623 Length:1009 Species:Homo sapiens


Alignment Length:39 Identity:13/39 - (33%)
Similarity:20/39 - (51%) Gaps:5/39 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 RNLKPIRLPSSAEGRRGS--SVASADRQQQ--QQLQHEC 286
            |:.:|: |.|.|...:|.  |:..|.|.:.  ||:.|.|
Human   288 RDSEPV-LDSGAFHGQGDTLSILPARRHKPCCQQVDHGC 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LManIINP_609408.1 PLN02701 47..823 CDD:178304 13/39 (33%)
GH38N_AMII_LAM_like 47..323 CDD:212121 13/39 (33%)
MAN2B2NP_056089.1 PLN02701 27..797 CDD:178304 13/39 (33%)
GH38N_AMII_Epman_like 27..352 CDD:212122 13/39 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 972..991
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.