DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManI and AT3G26720

Sequence 1:NP_001260350.1 Gene:LManI FlyBaseID:FBgn0032253 Length:950 Species:Drosophila melanogaster
Sequence 2:NP_189306.1 Gene:AT3G26720 AraportID:AT3G26720 Length:1019 Species:Arabidopsis thaliana

Alignment Length:996 Identity:373/997 (37%)
Similarity:554/997 (56%) Gaps:84/997 (8%)


  Fly     2 INVHLVPHSHDDVGWLKTVDQYYYGSQNKIQHAGVQYILDTVVEELLKDSSRRFIQVETFFFAKW 66
            |||||||||||||||||||||||.||.|.|:.|.||.:||:|:..||.|.:|:||.||..||.:|
plant    38 INVHLVPHSHDDVGWLKTVDQYYVGSNNSIRGACVQNVLDSVIASLLDDENRKFIYVEMAFFQRW 102

  Fly    67 YSEQTETVQRAVKKLVAQGRLEFAGGAWSMNDEATVHYQSVVDQFNLGLRYLKDTFGDCGRPTVG 131
            :.:|:...:..|||||..|:|||..|...|:||||.||..::||..||.:::|..||..  |.||
plant   103 WRQQSNAKKVKVKKLVDSGQLEFINGGMCMHDEATPHYIDMIDQTTLGHQFIKTEFGQV--PRVG 165

  Fly   132 WQIDPFGHSREMASIF-AQMAFNGEFFARMDYVDKKQRMLDLEMEMIWQSSESL-KNSNIFTGML 194
            |||||||||...|.:. |:..|:..||||:||.|:.:|:.:..:|:|||.|:|| .:|.||||:.
plant   166 WQIDPFGHSAVQAYLLGAEFGFDSLFFARIDYQDRAKRLREKTLEVIWQGSKSLGSSSQIFTGVF 230

  Fly   195 YNHYSAPPGFCFDINCEDAPIIDGE-SYDNNVDARVSEFIDYVKNMSKSYRSTHIMVPMGDDFQY 258
            ..||..|.||.|:||...|||.|.. .:|.||..||::|:..........|:.|||..||.||:|
plant   231 PRHYDPPEGFTFEINDVSAPIQDDPLLFDYNVQERVNDFVAAALAQVNVTRTNHIMWLMGTDFRY 295

  Fly   259 EDAAVNFKNMDKLIKYVNDRQSTGSQVNVFYSTPSCYLYELHQLKQTWPNKTEDFFPYSSDSHSY 323
            :.|...|:.:||.|.|||    ...::||.|||||.|....:...::||.||:|||||:...::|
plant   296 QYAYSWFRQIDKFIHYVN----KDGRLNVLYSTPSIYTDAKYAANESWPLKTDDFFPYADKPNAY 356

  Fly   324 WTGYFTSRPTQKRFHRDGNHFFQTVKQLSVLANLSGTQYSEDLDNLSQAMGIMQHHDAVTGTEKQ 388
            |||||||||..|::.||.:.::...:||..|.....:..:.|:  |:.|:.|.||||||:||::|
plant   357 WTGYFTSRPAFKKYVRDLSGYYLAARQLEFLRGRDSSGPTTDM--LADALAIAQHHDAVSGTQRQ 419

  Fly   389 AVASDYDRLLFKAIVGAENSARDALRSLTNLTSG--------EFESCLELNISVCAFTQD---TA 442
            .||:||...|....:.||.....:|..|:...|.        :|:.|..||||.|..::.   :.
plant   420 HVAADYALRLSMGYLQAEKLVASSLSFLSAAKSSTEKKNPGTKFQQCPLLNISYCPASEARLLSG 484

  Fly   443 NNVIVTLVNPLAHSSTQYVRVPAKNENYIVTDEKGREVFSEVVPVPWQVLALEHR---------P 498
            .:::|.:.|.|.....:.||||..:||.||.|..|:||..:::|:....|.:.:.         |
plant   485 KSLVVVVYNSLGWKREEVVRVPVSSENVIVKDASGKEVVFQLLPLSEIALRIRNEYVKAYLGRSP 549

  Fly   499 NDT-QHELVFEASVDKI--ANFLI-------RVLPSPKNIAEDQVQFPVERSQDELTVETSL--V 551
            .|| :|.|.|.|||..:  ::::|       |.| |...:....:...||..|..|.:..|.  |
plant   550 RDTAKHVLAFTASVPPLGFSSYVISDTGRTARGL-SASYVTSGSMNQNVEVGQGNLKLRYSEEGV 613

  Fly   552 KLTFDTTTGGLKTVKMNGFTENIQQTFGIYKGYRGNNGESKN-RSSGAYVFRPYGDIEIVN-NKV 614
            |:|...:|....|.:.:            |..|.|:||..|: ::||||||||.|.:.|.: .:.
plant   614 KITRHLSTKNQVTAEQS------------YAYYIGSNGTDKDPQASGAYVFRPDGVLPIKSKEEA 666

  Fly   615 ELSFYNGTKVKEVHQHVNEWISQVIRIYEDVNRVEFEWLVGPIPTDDDVGKEIITRFSSNISSKG 679
            :|:...|....||||.:|.||||:.|:|:..|..|.|:.:||||.||.:.|||||:.::.:.:.|
plant   667 QLTIVQGPLFDEVHQELNSWISQITRVYKGKNHAEIEFTIGPIPADDGISKEIITKLTTTMKTNG 731

  Fly   680 KFYTDSNGREILERERNQREHFTPDMSEAISGNYYPVTGQISLQDDEKRITLLNDRAQGGTSLKD 744
            .||||||||:.::|.|:.|..:...:.:.::|||||:...|.:||....:::|.|||.||:||::
plant   732 TFYTDSNGRDFIKRIRDFRTDWDLQVYQPVAGNYYPLNLGIYMQDKTSELSVLVDRAVGGSSLEN 796

  Fly   745 GELELMLHRRLLNDDAFGVGEALNET----QYGTGLIARGKIYLILDAV-DGKPNQRLLQHQLDQ 804
            |::|||||||:.:||..||||.||||    :...||..:||.|:.:|.. ||...:|....::..
plant   797 GQIELMLHRRMQHDDIRGVGEILNETVCLPEGCKGLTIQGKFYVQIDKPGDGAKWRRTFGQEIYS 861

  Fly   805 HFWKFFSKSNGVASVNR-----NMIPDFFGIPESVELLSLEPYSKDQILIRLENFNTEGNVVSFN 864
            .....|::..|.:.:|.     :.....:.:|::|.||:|:.....::|:||.:....|....::
plant   862 PLLIAFTEQEGDSWINSHKTTFSAFEPSYSLPKNVALLTLQELENGEVLLRLAHLFEVGEDSEYS 926

  Fly   865 IY------PLFESLDGYQIWETTLDGNMLLEDVKRFKFAQDGTGSIPSSVEYYHAPHNPLTANST 923
            :.      .||.:....::.||:|.||....::::.:......||....|:          ....
plant   927 VMAKVELKKLFHNKKIREVKETSLSGNQEKAEMEKRRLIWKVEGSAGEEVK----------RGEA 981

  Fly   924 MNASGFVVTLVPMQIRTFIIQ 944
            ::|...||.||||:|||.:|:
plant   982 VDAEKLVVELVPMEIRTLLIK 1002

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManINP_001260350.1 GH38N_AMII_LAM_like 2..276 CDD:212121 138/277 (50%)
Alpha-mann_mid 323..398 CDD:286360 33/75 (44%)
Glyco_hydro_38C 536..941 CDD:285047 140/425 (33%)
AT3G26720NP_189306.1 PLN02701 36..997 CDD:178304 370/990 (37%)
GH38N_AMII_LAM_like 38..314 CDD:212121 139/282 (49%)
Alpha-mann_mid 356..429 CDD:214875 33/75 (44%)
Glyco_hydro_38C 488..999 CDD:285047 170/534 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 649 1.000 Inparanoid score I165
OMA 1 1.010
OrthoDB 1 1.010 D201312at2759
OrthoInspector 1 1.000 T32165
orthoMCL 1 0.900 OOG5_129192
Panther 1 1.100 O PTHR11607
Phylome 1 0.910 0.728 Consistency score
87.980

Return to query results.
Submit another query.