DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManI and man2a2

Sequence 1:NP_001260350.1 Gene:LManI FlyBaseID:FBgn0032253 Length:950 Species:Drosophila melanogaster
Sequence 2:NP_001006777.1 Gene:man2a2 XenbaseID:XB-GENE-981388 Length:909 Species:Xenopus tropicalis

Alignment Length:786 Identity:242/787 (31%)
Similarity:359/787 (46%) Gaps:141/787 (18%)


  Fly     2 INVHLVPHSHDDVGWLKTVDQYYYGSQNKIQHAGVQYILDTVVEELLKDSSRRFIQVETFFFAKW 66
            :.|.:|||||:|.||:||.|:|||..        .|:||:.:|.:|.:|..|:||..|..||:||
 Frog   166 LQVFVVPHSHNDPGWIKTFDKYYYDQ--------TQHILNNMVVKLHEDPRRKFIWSEISFFSKW 222

  Fly    67 YSEQTETVQRAVKKLVAQGRLEFAGGAWSMNDEATVHYQSVVDQFNLGLRYLKDTFGDCGRPTVG 131
            :.......:.||::|||.|:||...|.|.|.|||..||.:::||...|.::||....  ..|..|
 Frog   223 WDNINSQKRAAVRRLVASGQLEMTTGGWVMPDEANTHYFAMIDQMIEGHQWLKKNLD--ATPRSG 285

  Fly   132 WQIDPFGHSREMASIFAQMAFNGEFFARMDYVDKKQRMLDLEMEMIW-QSSESLKNSNIFTGML- 194
            |.:||||||..|..|..:.........|:.|..||.......:|.:| |:.:...:::||..|: 
 Frog   286 WAVDPFGHSSTMPYILRRSNLTSMLIQRVHYSIKKHFAATQSLEFMWRQTWDPDSSTDIFCHMMP 350

  Fly   195 YNHYSAP------PGFC--FD--------INCEDAP--IIDGESYDNNVDARVSEFIDYVKNMSK 241
            :..|..|      |..|  ||        |||   |  :......|:||..|.:..:|..|..||
 Frog   351 FYSYDVPHTCGPDPKICCQFDFRRLPGGRINC---PWKVPPRAITDSNVAERANILLDQYKKKSK 412

  Fly   242 SYRSTHIMVPMGDDFQYE-----DAAVNFKNMDKLIKYVNDRQSTGSQVNVFYSTPSCYLYELHQ 301
            .|||..::||:||||:|:     ||  .|.|..||..|:|.....  .|...:.|.|.|...|::
 Frog   413 LYRSKVVLVPLGDDFRYDKIQEWDA--QFLNYQKLFDYMNSHPEL--HVQAQFGTLSDYFDALYK 473

  Fly   302 -------LK-QTWPNKTEDFFPYSSDSHSYWTGYFTSRPTQKRFHRDGNHFFQTVKQLSVL---- 354
                   :| ..:|..:.|||.|:.....|||||:||||..|...|......:..:.|..|    
 Frog   474 RMGVVPGIKPPDFPVVSGDFFSYADREDHYWTGYYTSRPFYKSMDRVLESHLRGAEILYSLAINH 538

  Fly   355 ANLSGTQYSEDLDN---LSQA---MGIMQHHDAVTGTEKQAVASDYDRLLFKAIVGAENSARDAL 413
            |..:||:....|.:   |:.|   :|:.|||||:|||.|:||..||...|..:::   |..|..:
 Frog   539 ARKAGTESKYPLSDYALLTDARRNLGLFQHHDAITGTAKEAVVIDYGVRLLHSLM---NLKRIII 600

  Fly   414 RSLTNLTSGEFESCLELNISVCAFTQD-----------------TANNVIVTLVNPLAHSSTQYV 461
            .:...|...:.|. ...:.||..|:.|                 ||:...|.:.||:..:....|
 Frog   601 NAAHYLVVADKEK-YHYDHSVPFFSTDESRLTQESLPEKTVIKLTASPRYVVVFNPVEQNRLCVV 664

  Fly   462 RVPAKNENYIVTDEKGREVFSEVVPVPWQVLALEHRPNDTQHEL----------VFE--ASVDK- 513
            .:.....|..|..|.|:.|.:::.|| ||.:. :..|:..|...          :|:  ||:|. 
 Frog   665 SLLVNTYNVRVLTEDGQPVAAQLSPV-WQSVT-DMNPDVYQVSFTARLPSLGLSIFQLHASIDTH 727

  Fly   514 ---IANFLIRVLPSPKNIAEDQVQFPV---ERSQDELTVETSLVKLTFDTTTGGLKTVKMNG--F 570
               .:|..:.:.....:|.:..| |||   |.|.|:..:|...:::.|..|||.||::|..|  .
 Frog   728 TTLKSNVRVHLHGRELSIKKQDV-FPVKVAESSTDDFHIENQYMQVWFSGTTGLLKSIKRAGEEQ 791

  Fly   571 TENIQQTFGIYKGYRGNNGESKNRSSGAYVFRPYGDIEIVNNK-------VELSFYNGTKVKEVH 628
            .:.|...|.|| |.|    .||:: ||||:|.|.|:.:....|       .|..||  ::|...:
 Frog   792 EQKINMQFLIY-GTR----TSKDK-SGAYLFLPDGEAKPYTPKDPPVVKVTEGPFY--SEVTCQY 848

  Fly   629 QHVNEWISQVIRIYE---------DVNRVEFEWLVGPIPTDDDVGKEIITRFSSNISSKGKFYTD 684
            |||    .||:|:|.         |::.:        |...|.|.|||..|.|::|.|:..|:||
 Frog   849 QHV----QQVMRLYNLPGTEGLSLDISSL--------IDIRDHVNKEIAMRLSTDIQSEDIFFTD 901

  Fly   685 SNGREI 690
            .||.::
 Frog   902 LNGFQV 907

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManINP_001260350.1 GH38N_AMII_LAM_like 2..276 CDD:212121 106/299 (35%)
Alpha-mann_mid 323..398 CDD:286360 33/85 (39%)
Glyco_hydro_38C 536..941 CDD:285047 57/177 (32%)
man2a2NP_001006777.1 PLN02701 128..>906 CDD:178304 242/784 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.