DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManI and MAN2B1

Sequence 1:NP_001260350.1 Gene:LManI FlyBaseID:FBgn0032253 Length:950 Species:Drosophila melanogaster
Sequence 2:XP_005259970.1 Gene:MAN2B1 HGNCID:6826 Length:1012 Species:Homo sapiens

Alignment Length:989 Identity:423/990 (43%)
Similarity:574/990 (58%) Gaps:81/990 (8%)


  Fly     1 MINVHLVPHSHDDVGWLKTVDQYYYGSQNKIQHAGVQYILDTVVEELLKDSSRRFIQVETFFFAK 65
            |:||||:||:|||||||||||||:||.:|.|||||||||||:|:..||.|.:||||.||..||::
Human    62 MLNVHLLPHTHDDVGWLKTVDQYFYGIKNDIQHAGVQYILDSVISALLADPTRRFIYVEIAFFSR 126

  Fly    66 WYSEQTETVQRAVKKLVAQGRLEFAGGAWSMNDEATVHYQSVVDQFNLGLRYLKDTFGDCGRPTV 130
            |:.:||...|..|:.||.|||||||.|.|.|||||..||.::|||..||||:|:||||:.|||.|
Human   127 WWHQQTNATQEVVRDLVRQGRLEFANGGWVMNDEAATHYGAIVDQMTLGLRFLEDTFGNDGRPRV 191

  Fly   131 GWQIDPFGHSREMASIFAQMAFNGEFFARMDYVDKKQRMLDLEMEMIWQSSESLK--NSNIFTGM 193
            .|.|||||||||.||:||||.|:|.||.|:||.||..||..||||.:|::|.|||  .:::|||:
Human   192 AWHIDPFGHSREQASLFAQMGFDGFFFGRLDYQDKWVRMQKLEMEQVWRASTSLKPPTADLFTGV 256

  Fly   194 LYNHYSAPPGFCFDINCEDAPII-DGESYDNNVDARVSEFIDYVKNMSKSYRSTHIMVPMGDDFQ 257
            |.|.|:.|...|:|:.|.|.|:: |..|.:.|....|..|::......:.||:.|.::.||.|||
Human   257 LPNGYNPPRNLCWDVLCVDQPLVEDPRSPEYNAKELVDYFLNVATAQGRYYRTNHTVMTMGSDFQ 321

  Fly   258 YEDAAVNFKNMDKLIKYVN-DRQSTGSQVNVFYSTPSCYLYELHQLKQTWPNKTEDFFPYSSDSH 321
            ||:|.:.|||:||||:.|| .:|:.||.|:|.||||:|||:||::...||..|.:|||||:...|
Human   322 YENANMWFKNLDKLIRLVNAQQQAKGSSVHVLYSTPACYLWELNKANLTWSVKHDDFFPYADGPH 386

  Fly   322 SYWTGYFTSRPTQKRFHRDGNHFFQTVKQLSVLANLS---GTQYSEDLDNLSQAMGIMQHHDAVT 383
            .:|||||:|||..||:.|...:|.|...||..|..|:   |...|.|...|::||.::||||||:
Human   387 QFWTGYFSSRPALKRYERLSYNFLQVCNQLEALVGLAANVGPYGSGDSAPLNEAMAVLQHHDAVS 451

  Fly   384 GTEKQAVASDYDRLLFKAIVGAENSARDALRSLTNLTSGEFESCLELNISVCAFTQDTANNVIVT 448
            ||.:|.||:||.|.|.......|....:||..|... ...|..|.:||||:|..:| ||....|.
Human   452 GTSRQHVANDYARQLAAGWGPCEVLLSNALARLRGF-KDHFTFCQQLNISICPLSQ-TAARFQVI 514

  Fly   449 LVNPLAHSSTQYVRVPAKNENYIVTDEKGREVFSEVVPVPWQVLALEHRPNDTQ-H--ELVFEAS 510
            :.|||.......||:|.....::|.|..||.|.|:||..|         .:|:| |  ||:|.||
Human   515 VYNPLGRKVNWMVRLPVSEGVFVVKDPNGRTVPSDVVIFP---------SSDSQAHPPELLFSAS 570

  Fly   511 VDKI--ANFLIRVLPSPKNIAEDQVQFPVERSQDELTVETSLVKLTFDTTTGGL-KTVKMN-GFT 571
            :..:  :.:.:..:|..|..|......|.......||:|...::.|||..||.| :.:.|| ...
Human   571 LPALGFSTYSVAQVPRWKPQARAPQPIPRRSWSPALTIENEHIRATFDPDTGLLMEIMNMNQQLL 635

  Fly   572 ENIQQTFGIYKGYRGNNGESKNRSSGAYVFRP----------YGDIEIVNNKVELSFYNGTKVKE 626
            ..::|||..|....|:|  ..:::||||:|||          :..|.:|...:         |:|
Human   636 LPVRQTFFWYNASIGDN--ESDQASGAYIFRPNQQKPLPVSRWAQIHLVKTPL---------VQE 689

  Fly   627 VHQHVNEWISQVIRIYEDVNRVEFEWLVGPIPTDDDVGKEIITRFSSNISSKGKFYTDSNGREIL 691
            |||:.:.|.|||:|:|.....:|.||.|||||..|..|||:|:||.:.:.:||:|||||||||||
Human   690 VHQNFSAWCSQVVRLYPGQRHLELEWSVGPIPVGDTWGKEVISRFDTPLETKGRFYTDSNGREIL 754

  Fly   692 ERERNQREHFTPDMSEAISGNYYPVTGQISLQDDEKRITLLNDRAQGGTSLKDGELELMLHRRLL 756
            ||.|:.|..:..:.:|.::||||||..:|.:.|...::|:|.||:|||:||:||.||||:|||||
Human   755 ERRRDYRPTWKLNQTEPVAGNYYPVNTRIYITDGNMQLTVLTDRSQGGSSLRDGSLELMVHRRLL 819

  Fly   757 NDDAFGVGEALNETQYGTGLIARGKIYLILD-AVDGKPNQRLLQHQLDQHFWKFFSKSNGVASVN 820
            .||..||.|.|.|.  |:|...||:..::|| |.......|||..| :....:......|.|:.|
Human   820 KDDGRGVSEPLMEN--GSGAWVRGRHLVLLDTAQAAAAGHRLLAEQ-EVLAPQVVLAPGGGAAYN 881

  Fly   821 RNMIP--DFFG----IPESVELLSLEPYSKDQILIRLENFNTEGN--------VVSFNIYPLFES 871
            ....|  .|.|    :|.||.||:|..:..:.:|:|||:....|.        .|:.|:..||.:
Human   882 LGAPPRTQFSGLRRDLPPSVHLLTLASWGPEMVLLRLEHQFAVGEDSGRNLSAPVTLNLRDLFST 946

  Fly   872 LDGYQIWETTLDGNMLLEDVKRFKFAQDGTGSIPSSVEYYHAPHNPLTANSTMNASGFVVTLVPM 936
            ....::.||||..|.|.|...|.|:..: ||..|....|...|.|              :||.||
Human   947 FTITRLQETTLVANQLREAASRLKWTTN-TGPTPHQTPYQLDPAN--------------ITLEPM 996

  Fly   937 QIRTFI--IQQKYI 948
            :||||:  :|.|.:
Human   997 EIRTFLASVQWKEV 1010

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManINP_001260350.1 GH38N_AMII_LAM_like 2..276 CDD:212121 156/277 (56%)
Alpha-mann_mid 323..398 CDD:286360 37/78 (47%)
Glyco_hydro_38C 536..941 CDD:285047 160/432 (37%)
MAN2B1XP_005259970.1 PLN02701 63..1001 CDD:178304 419/978 (43%)
GH38N_AMII_LAM_like 63..341 CDD:212121 157/278 (56%)
Alpha-mann_mid 388..466 CDD:214875 37/78 (47%)
Glyco_hydro_38C 511..1001 CDD:285047 187/528 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64883362
eggNOG 1 0.900 E1_KOG1959
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 811 1.000 Inparanoid score I479
Isobase 1 0.950 0 Normalized mean entropy S4230
OMA 1 1.010
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
OrthoInspector 1 1.000 T609335
orthoMCL 1 0.900 OOG5_129192
Panther 1 1.100 O PTHR11607
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.720

Return to query results.
Submit another query.