DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManI and MAN2A1

Sequence 1:NP_001260350.1 Gene:LManI FlyBaseID:FBgn0032253 Length:950 Species:Drosophila melanogaster
Sequence 2:NP_002363.2 Gene:MAN2A1 HGNCID:6824 Length:1144 Species:Homo sapiens

Alignment Length:1076 Identity:286/1077 (27%)
Similarity:464/1077 (43%) Gaps:232/1077 (22%)


  Fly     2 INVHLVPHSHDDVGWLKTVDQYYYGSQNKIQHAGVQYILDTVVEELLKDSSRRFIQVETFFFAKW 66
            :.|.:|||||:|.|||||.:.|:   ::|     .|||.:.:|.:|.:||.|:||..|..:.:||
Human   166 LQVFVVPHSHNDPGWLKTFNDYF---RDK-----TQYIFNNMVLKLKEDSRRKFIWSEISYLSKW 222

  Fly    67 YSEQTETVQRAVKKLVAQGRLEFAGGAWSMNDEATVHYQSVVDQFNLGLRYLKDTFGDCGRPTVG 131
            :.......:.|||.|:..|:||...|.|.|.||||.||.:::||...|.::|::..|  .:|..|
Human   223 WDIIDIQKKDAVKSLIENGQLEIVTGGWVMPDEATPHYFALIDQLIEGHQWLENNIG--VKPRSG 285

  Fly   132 WQIDPFGHSREMASIFAQMAFNGEFFARMDYVDKKQRMLDLEMEMIWQSSESLKN-SNIFTGML- 194
            |.|||||||..||.:..:...:.....|:.|..||...|...:|..|:.:..|.: ::|...|: 
Human   286 WAIDPFGHSPTMAYLLNRAGLSHMLIQRVHYAVKKHFALHKTLEFFWRQNWDLGSVTDILCHMMP 350

  Fly   195 YNHYSAP------PGFCFDINCEDAP---------IIDGESYDNNVDARVSEFIDYVKNMSKSYR 244
            :..|..|      |..|...:.:..|         :.....:..||.:|....:|..:..||.:|
Human   351 FYSYDIPHTCGPDPKICCQFDFKRLPGGRFGCPWGVPPETIHPGNVQSRARMLLDQYRKKSKLFR 415

  Fly   245 STHIMVPMGDDF---QYEDAAVNFKNMDKLIKYVNDRQSTGSQVNVFYSTPSCYLYELHQLKQT- 305
            :..::.|:||||   :|.:..:.|||..:|..|:|.:..  .:|.:.:.|.|.:...|.:..:| 
Human   416 TKVLLAPLGDDFRYCEYTEWDLQFKNYQQLFDYMNSQSK--FKVKIQFGTLSDFFDALDKADETQ 478

  Fly   306 -------WPNKTEDFFPYSSDSHSYWTGYFTSRPTQKRFHRDGNHFFQTVKQLSVLA-------- 355
                   :|..:.|||.|:.....||:|||||||..||..|......:..:.|...|        
Human   479 RDKGQSMFPVLSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESHLRAAEILYYFALRQAHKYK 543

  Fly   356 ---NLSGTQYSEDLDNLSQAMGIMQHHDAVTGTEKQAVASDYDRLLFKAIVGAE----NSA---- 409
               .||.:.|:. |....:.:|:.|||||:|||.|..|..||...||.:::..|    |||    
Human   544 INKFLSSSLYTA-LTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFHSLMVLEKIIGNSAFLLI 607

  Fly   410 -RDALRSLTNLTSGEFESCLELNISVCAFTQDT--ANNVI--------VTLVNPLAHSSTQYVRV 463
             :|      .||...:.....|.:.:...:||:  ..|:|        :.:.|||.......|.|
Human   608 LKD------KLTYDSYSPDTFLEMDLKQKSQDSLPQKNIIRLSAEPRYLVVYNPLEQDRISLVSV 666

  Fly   464 PAKNENYIVTDEKGREVFSEVVPVPWQVLALEHRPN---DTQHELVFEASVDKIANFLIRVLPSP 525
            ...:....|....|:       ||..||.|:....|   :|.:|:.|.|.:..:...:.::|.|.
Human   667 YVSSPTVQVFSASGK-------PVEVQVSAVWDTANTISETAYEISFRAHIPPLGLKVYKILESA 724

  Fly   526 ------------KNIAEDQVQFPVE---RSQDELTVETSLVKLTFDTTTGGLKTV--KMNGFTEN 573
                        ||..||...|.::   .:::.:|:|.|.|.|.|| .||.:|.:  |.:|....
Human   725 SSNSHLADYVLYKNKVEDSGIFTIKNMINTEEGITLENSFVLLRFD-QTGLMKQMMTKEDGKHHE 788

  Fly   574 IQQTFGIYKGYRGNNGES-KNRSSGAYVFRPYGD--------------------------IEIVN 611
            :...|..|       |.: |...||||:|.|.|:                          .:.|.
Human   789 VNVQFSWY-------GTTIKRDKSGAYLFLPDGNAKPYVYTTPPFVRVTHGRIYSEVTCFFDHVT 846

  Fly   612 NKVELSFYNGTKVKEVHQHVNEWISQVIRIYEDVNRVEFEWLVGPIPTDDDVGKEIITRFSSNIS 676
            ::|.|....|.:.:.|.      :|.::.|.:..||                  ||..:.||:|.
Human   847 HRVRLYHIQGIEGQSVE------VSNIVDIRKVYNR------------------EIAMKISSDIK 887

  Fly   677 SKGKFYTDSNGREILERERNQREHFTPDMSEA---ISGNYYPVTGQISLQDDEKRITLLNDRAQG 738
            |:.:||||.||.:|           .|.|:.:   :..|.||:|....:||.:.|:|||:.::.|
Human   888 SQNRFYTDLNGYQI-----------QPRMTLSKLPLQANVYPMTTMAYIQDAKHRLTLLSAQSLG 941

  Fly   739 GTSLKDGELELMLHRRLLNDDAFGVGEALNETQYGTGLIARGKIYLILD---AVDGKPNQR---- 796
            .:||..|::|:::.|||:.||..|:.:.:.:.:....|..     ::|:   ||:.:..::    
Human   942 VSSLNSGQIEVIMDRRLMQDDNRGLEQGIQDNKITANLFR-----ILLEKRSAVNTEEEKKSVSY 1001

  Fly   797 --LLQH---QLDQHFWKFFSKSNGVASVNRNMIPDF----FGIPESVELLSLEP--------YSK 844
              ||.|   .|..|  .....:|..:|....:..:|    ..:|..:.|::|..        :|.
Human  1002 PSLLSHITSSLMNH--PVIPMANKFSSPTLELQGEFSPLQSSLPCDIHLVNLRTIQSKVGNGHSN 1064

  Fly   845 DQILIRLENFNTEGNVVSFNIYPLFESLDGYQIWETTLDGNMLLEDVKRFKFAQDGTGSIPSSVE 909
            :..||    .:.:|....|       |..|..::.:|..|.:|::.:.. ||..:..  .|||:.
Human  1065 EAALI----LHRKGFDCRF-------SSKGTGLFCSTTQGKILVQKLLN-KFIVESL--TPSSLS 1115

  Fly   910 YYHAPHNPLTAN-STMNASGFVVTLVPMQIRTFIIQ 944
            ..|:|  |.|.| |.:|.|       ||:|.||.||
Human  1116 LMHSP--PGTQNISEINLS-------PMEISTFRIQ 1142

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManINP_001260350.1 GH38N_AMII_LAM_like 2..276 CDD:212121 93/294 (32%)
Alpha-mann_mid 323..398 CDD:286360 31/86 (36%)
Glyco_hydro_38C 536..941 CDD:285047 110/465 (24%)
MAN2A1NP_002363.2 PLN02701 128..1144 CDD:178304 286/1077 (27%)
GH38N_Man2A1 165..508 CDD:212131 108/354 (31%)
Alpha-mann_mid 503..588 CDD:214875 31/86 (36%)
Glyco_hydro_38C 754..1139 CDD:285047 110/458 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.