DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManI and MAN2A2

Sequence 1:NP_001260350.1 Gene:LManI FlyBaseID:FBgn0032253 Length:950 Species:Drosophila melanogaster
Sequence 2:NP_001307906.1 Gene:MAN2A2 HGNCID:6825 Length:1175 Species:Homo sapiens

Alignment Length:1096 Identity:289/1097 (26%)
Similarity:462/1097 (42%) Gaps:247/1097 (23%)


  Fly     2 INVHLVPHSHDDVGWLKTVDQYYYGSQNKIQHAGVQYILDTVVEELLKDSSRRFIQVETFFFAKW 66
            :.|.:|||||:|.||:||.|:||...        .|:||:::|.:|.:|..|||:..|..|||||
Human   166 LQVFVVPHSHNDPGWIKTFDKYYTEQ--------TQHILNSMVSKLQEDPRRRFLWAEVSFFAKW 222

  Fly    67 YSEQTETVQRAVKKLVAQGRLEFAGGAWSMNDEATVHYQSVVDQFNLGLRYLKDTFGDCGRPTVG 131
            :.......:.||::||..|:||.|.|.|.|.|||..||.:::||...|.::|:...|  ..|..|
Human   223 WDNINVQKRAAVRRLVGNGQLEIATGGWVMPDEANSHYFALIDQLIEGHQWLERNLG--ATPRSG 285

  Fly   132 WQIDPFGHSREMASIFAQMAFNGEFFARMDYVDKKQRMLDLEMEMIW-QSSESLKNSNIFTGML- 194
            |.:||||:|..|..:..:.........|:.|..||.......:|.:| |:.:|..:::||..|: 
Human   286 WAVDPFGYSSTMPYLLRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCHMMP 350

  Fly   195 YNHYSAP------PGFC--FD--------INC--EDAPIIDGESYDNNVDARVSEFIDYVKNMSK 241
            :..|..|      |..|  ||        |||  :..|....|:   ||..|.:..:|..:..|:
Human   351 FYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPWKVPPRAITEA---NVAERAALLLDQYRKKSQ 412

  Fly   242 SYRSTHIMVPMGDDFQYE-----DAAVNFKNMDKLIKYVNDRQSTGSQVNVFYSTPSCYLYELHQ 301
            .:||..::||:||||:|:     ||  .|.|..:|..:.|.|.:.  .|...:.|.|.|...|: 
Human   413 LFRSNVLLVPLGDDFRYDKPQEWDA--QFFNYQRLFDFFNSRPNL--HVQAQFGTLSDYFDALY- 472

  Fly   302 LKQT----------WPNKTEDFFPYSSDSHSYWTGYFTSRPTQKRFHRDGNHFFQTVKQLSVLA- 355
             |:|          :|..:.|||.|:.....|||||:||||..|...|......:..:.|..|| 
Human   473 -KRTGVEPGARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEVLYSLAA 536

  Fly   356 ------NLSGTQYSEDLDNLSQA---MGIMQHHDAVTGTEKQAVASDYDRLLFKAIVGAENSARD 411
                  .|:|.....|...|::|   :|:.|||||:|||.|:||..||...|.:::|   |..:.
Human   537 AHARRSGLAGRYPLSDFTLLTEARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLV---NLKQV 598

  Fly   412 ALRSLTNLTSGEFES--------CLELN---ISVCAFTQDTANNV-----IVTLVNPLAHSSTQY 460
            .:.:...|..|:.|:        .|:::   :|..|..:.|...:     .|.|.|||.......
Human   599 IIHAAHYLVLGDKETYHFDPEAPFLQVDDTRLSHDALPERTVIQLDSSPRFVVLFNPLEQERFSM 663

  Fly   461 VRVPAKNENYIVTDEKGREV----------FSEVVPVPWQVLALEHRPNDTQHELVFEASVDKIA 515
            |.:...:....|..|:|:.:          .:|.||..:||......|......|..:..:|.  
Human   664 VSLLVNSPRVRVLSEEGQPLAVQISAHWSSATEAVPDVYQVSVPVRLPALGLGVLQLQLGLDG-- 726

  Fly   516 NFLIRVLPSPKNIAEDQVQFPVERSQ-----------DELTVETSLVKLTFDTTTGGLKTVKM-- 567
               .|.|||...|.....|..|.|.:           .:..:....:::.|...||.||:::.  
Human   727 ---HRTLPSSVRIYLHGRQLSVSRHEAFPLRVIDSGTSDFALSNRYMQVWFSGLTGLLKSIRRVD 788

  Fly   568 NGFTENIQQTFGIYKGYRGNNGESKNRSSGAYVFRPYGDIE--IVNNKVELSFYNGTKVKEV--- 627
            ....:.:.....:| |.|    .||:: ||||:|.|.|:.:  :......|....|....||   
Human   789 EEHEQQVDMQVLVY-GTR----TSKDK-SGAYLFLPDGEAKPYVPKEPPVLRVTEGPFFSEVVAY 847

  Fly   628 HQHVNEWISQVIRIYE---------DVNRVEFEWLVGPIPTDDDVGKEIITRFSSNISSKGKFYT 683
            ::|::    |.:|:|.         |::.:        :...|.|.||:.....::|.|:|.|:|
Human   848 YEHIH----QAVRLYNLPGVEGLSLDISSL--------VDIRDYVNKELALHIHTDIDSQGIFFT 900

  Fly   684 DSNGREILERERNQREHFTPDMSEAISGNYYPVTGQISLQDDEKRITLLNDRAQGGTSLKDGELE 748
            |.||.::..|...::   .|     :..|:||:.....:||.:||:||...:|.|.:|||||:||
Human   901 DLNGFQVQPRRYLKK---LP-----LQANFYPMPVMAYIQDAQKRLTLHTAQALGVSSLKDGQLE 957

  Fly   749 LMLHRRLLNDDAFGVGEALNETQYGTGLIARGKIYLILDAVDGKPN---------QRLLQHQ--- 801
            ::|.|||:.||..|:|:.|.:.:....   |.::.|....|..:|:         :.|:.|.   
Human   958 VILDRRLMQDDNRGLGQGLKDNKRTCN---RFRLLLERRTVGSEPDFFSKLAAMFRGLIFHSSRS 1019

  Fly   802 -----LDQHFWKFFSKSNGVASVN--------------------RNMIPDFFGIPESVELLSLE- 840
                 .|.|...:.|..:.:.|:.                    |:..|....:|....||:|. 
Human  1020 GNREVQDSHSTSYPSLLSHLTSMYLNAPALALPVARMQLPGPGLRSFHPLASSLPCDFHLLNLRT 1084

  Fly   841 --------PYSKDQILIRLENFN--TEGNVVSFNIYPLFESLDGYQIWETTLDGNMLLEDVKRFK 895
                    |.::..:::..:.|:  .|...:.||.              ||..|.:.|       
Human  1085 LQAEEDTLPSAETALILHRKGFDCGLEAKNLGFNC--------------TTSQGKVAL------- 1128

  Fly   896 FAQDGTGSI----------PSSVEYYHAPHNPLTANSTMNASGFVVTLVPMQIRTF 941
                  ||:          |:|:...:...:|  :|||      .|.|.||:|.||
Human  1129 ------GSLFHGLDVVFLQPTSLTLLYPLASP--SNST------DVYLEPMEIATF 1170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManINP_001260350.1 GH38N_AMII_LAM_like 2..276 CDD:212121 100/299 (33%)
Alpha-mann_mid 323..398 CDD:286360 33/85 (39%)
Glyco_hydro_38C 536..941 CDD:285047 108/490 (22%)
MAN2A2NP_001307906.1 PLN02701 136..1174 CDD:178304 289/1097 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.