DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManI and Man2b2

Sequence 1:NP_001260350.1 Gene:LManI FlyBaseID:FBgn0032253 Length:950 Species:Drosophila melanogaster
Sequence 2:NP_001128443.1 Gene:Man2b2 RGDID:1308840 Length:1004 Species:Rattus norvegicus

Alignment Length:1061 Identity:282/1062 (27%)
Similarity:448/1062 (42%) Gaps:206/1062 (19%)


  Fly     2 INVHLVPHSHDDVGWLKTVDQYYYGSQNKIQHAGVQYILDTVVEELLKDSSRRFIQVETFFFAKW 66
            |...:|||||.||||:.||.:        ...|....:..||||||::...||||.||..||..|
  Rat    27 IRAFVVPHSHMDVGWVYTVQE--------SMRAYAANVYTTVVEELVRGRQRRFIAVEQEFFRLW 83

  Fly    67 Y----SEQTETVQRAVKKLVAQGRLEFAGGAWSMNDEATVHYQSVVDQFNLGLRYLKDTFGDCGR 127
            :    |||.   ::.|::|:.:|.|||..|...|:|||..|....:.|...|..:|.:|||.  |
  Rat    84 WDGVASEQQ---KQQVRQLLDEGCLEFVLGGQVMHDEAVTHLDDQILQLTEGHGFLYETFGI--R 143

  Fly   128 PTVGWQIDPFGHSREMASIFAQMAFNGEFFARMDYVDKKQRMLDLE-MEMIWQSSESL-KNSNIF 190
            |...|.:||||.|....::|:...||....:|:|| |.|..|.:.: ::.:|..|.|| :...|:
  Rat   144 PQFSWHVDPFGASATTPTLFSLAGFNAHLISRIDY-DLKDAMQEAQGLQFVWHGSPSLSEQQEIY 207

  Fly   191 TGM--LYNH-------YSAPPGFCFD-INCEDAPIIDGESYDN--------NVDARVSEFIDYVK 237
            |.:  ||::       :|...||.:: :.....|..|| .|.|        |:.......:..:|
  Rat   208 THVMDLYSYCTPSHIPFSNRSGFYWNGVAVFPEPPPDG-VYPNMSEPVTVDNIHLYAEALVANIK 271

  Fly   238 NMSKSYRSTHIMVPMGDDFQYEDAAVNFKNMDKLIKYVNDRQSTGSQVNVFYSTPSCYLYELHQL 302
            ..:..:|:.|::.|.|.|.|:.:|:|.|.|||.|::|:|:| |....::|.|:|.:.|...||..
  Rat   272 QRAAWFRTPHVLWPWGCDKQFFNASVQFDNMDPLLEYINNR-SAQFGISVQYATLNDYFQALHDF 335

  Fly   303 KQTWPNKT-EDFFPYSSDSHSYWTGYFTSRPTQKRFHRD-------GNHFFQTVKQLSVLANLSG 359
            ..||..:. .||.||||:....|||::|||.|.|...|.       |...|...........|..
  Rat   336 NVTWDIRDHHDFLPYSSEPQQAWTGFYTSRSTLKGLARQASALLYAGESMFTRYMWPHPRGTLDP 400

  Fly   360 TQYSEDLDNLSQAMGIMQHHDAVTGTEKQAVASDYDRLLFKAIVGAENSARDALRSLTNLTSGEF 424
            |...:.|..|..|:..:|||||:||||...|.:.|...|...:.|..                :.
  Rat   401 TWALQQLQQLRWAVSEVQHHDAITGTESPKVKNMYMEHLSMGMRGVH----------------KL 449

  Fly   425 ESCLELNISVCAFTQDTANNVIVTLVNPLAHSSTQYVRVPAKNENYIVTDEKGREVFSEVV---- 485
            .:.:.|:.|..:.|.........::.||||...|..:.:.....:..||||.||.|.:::.    
  Rat   450 MASIALDRSPGSGTDTRPVGYSASVYNPLAWKITTIITLTVAFPSVSVTDELGRPVSAQIQNSTK 514

  Fly   486 -PVPWQVLALEHRPNDTQHELVFEASVDKIANFL-----IRVLPSPK-NIAEDQVQFPVERSQDE 543
             |..:.:|.|...|.       ......|:...|     .|.|.:|: |..:...:...:.||:.
  Rat   515 DPSAYDLLILTTIPG-------LSYRYYKVRRILGDQAGTRELVTPRANTLKFSRKLRNQTSQEG 572

  Fly   544 ---LTVETSLVKLTFDTTTGGLKTV--KMNGFTENIQQTFGIYKGYRGNNGESKNRSSGAYVFRP 603
               :.|......|.||..|..|.::  :.:..|.::.|.|   ..||.|....:...|..|:|..
  Rat   573 KLLVPVMNDCYTLLFDQDTNMLHSIQDRQSNRTVHMTQEF---LEYRANGDVKQGPISDNYLFAS 634

  Fly   604 YGDIEIVNNKVELSFYNGTKVKEVHQHVNEWISQVIRIYED----------------VNRVEFEW 652
            ....|.....|.:....||...:|.|:....|:....||..                ..|:|.::
  Rat   635 NDTAEPSWEAVGMEMVVGTLATDVRQYFYRNITDQGYIYSIHTRLAHVHPSLAGELLCRRIEQQY 699

  Fly   653 LVGPIPTDDDVGKEIITRFSSNISSKGKFYTDSNGREILERERNQREHFTPDMSEAISGNYYPVT 717
            .|||:    |:.:|.|.|.||:::|:...|:|:||.::      ||..:....|..|..||||:.
  Rat   700 QVGPL----DLNREAILRTSSDLNSQQVLYSDNNGYQM------QRRPYKAFKSNPIPRNYYPMV 754

  Fly   718 GQISLQDDEKRITLLNDRAQGGTSLKDGELELMLHRRLLNDDAFGVGE--ALNETQYGTGLIARG 780
            ....::||:.|:.||.:|..|.:|.::|::|:||||||.|:..:.:..  .||:|.     :...
  Rat   755 QSAFIEDDKSRLVLLAERPHGVSSQENGQVEVMLHRRLWNNLVWDLNYNLTLNDTS-----VVHP 814

  Fly   781 KIYLILD--------------AVDGKPNQRLLQHQLDQHFWKFFSKSNGVASVNRNMIPDFFGIP 831
            .::|:|.              |:..:| ..||:...|:.          ..:::|...|....:|
  Rat   815 VLWLLLGPKSTTTALRPRSGVALQHRP-VVLLKELTDEE----------ETAIHRPHHPWPVTLP 868

  Fly   832 ESVEL--LSLE--PYSKD--QILIRLENFNTEGNVVS-----FNIYPLFES-LDGYQIWETTLDG 884
            .|:.|  |||.  .||::  |.|..|:..:.|...|:     ..::.|:|: .|.......|:| 
  Rat   869 PSLHLQVLSLRGWQYSRNHAQHLKNLQRGHPEKPQVNLQRVLLRLHHLYEAGEDPVLSRPATVD- 932

  Fly   885 NMLLEDVKRFKFAQDGTGSIPS-------------SVEYYH--------------APHNPLTANS 922
                     .|.|..|.||:.:             :::.:|              .|.:|     
  Rat   933 ---------LKIALRGLGSVVAVEERSLTGTWDVQTLQRWHWRTKIGQLKGHPTSPPRSP----- 983

  Fly   923 TMNASGFVVTLVPMQIRTFII 943
                .|.::|:.|.:||||.|
  Rat   984 ----GGSIITVYPKEIRTFFI 1000

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManINP_001260350.1 GH38N_AMII_LAM_like 2..276 CDD:212121 98/298 (33%)
Alpha-mann_mid 323..398 CDD:286360 27/82 (33%)
Glyco_hydro_38C 536..941 CDD:285047 111/481 (23%)
Man2b2NP_001128443.1 GH38N_AMII_Epman_like 27..352 CDD:212122 114/341 (33%)
Alpha-mann_mid 358..439 CDD:214875 27/81 (33%)
Glyco_hydro_38C 474..998 CDD:285047 133/579 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11607
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.