DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManI and LManII

Sequence 1:NP_001260350.1 Gene:LManI FlyBaseID:FBgn0032253 Length:950 Species:Drosophila melanogaster
Sequence 2:NP_609408.1 Gene:LManII FlyBaseID:FBgn0027611 Length:1080 Species:Drosophila melanogaster

Alignment Length:1059 Identity:497/1060 (47%)
Similarity:655/1060 (62%) Gaps:145/1060 (14%)


  Fly     1 MINVHLVPHSHDDVGWLKTVDQYYYGSQNKIQHAGVQYILDTVVEELLKDSSRRFIQVETFFFAK 65
            |:|||||.|:|||||||||||||||||:.|||.||||||:|:|||.||:|..:|||.||:.||.|
  Fly    46 MLNVHLVAHTHDDVGWLKTVDQYYYGSETKIQKAGVQYIIDSVVEALLRDPEKRFIYVESAFFFK 110

  Fly    66 WYSEQTETVQRAVKKLVAQGRLEFAGGAWSMNDEATVHYQSVVDQFNLGLRYLKDTFGDCGRPTV 130
            |:.||...||.|||.||.||||||.|||||||||||.|||||:|||:.|||.|.||||:||||.|
  Fly   111 WWKEQKPKVQEAVKMLVEQGRLEFIGGAWSMNDEATTHYQSVIDQFSWGLRLLNDTFGECGRPRV 175

  Fly   131 GWQIDPFGHSREMASIFAQMAFNGEFFARMDYVDKKQRMLDLEMEMIWQSSESL-KNSNIFTGML 194
            |||||||||||||||:||||.|:|.||.|:||.||.:|::....||||..|.:| :.:::|:|.|
  Fly   176 GWQIDPFGHSREMASMFAQMGFDGMFFGRLDYQDKDERLMTKNAEMIWHGSANLGEEADLFSGAL 240

  Fly   195 YNHYSAPPGFCFDINCEDAPIIDGE-SYDNNVDARVSEFIDYVKNMSKSYRSTHIMVPMGDDFQY 258
            ||:|.||.||||||.|.|||||||: |.||||..|:..|:|:.|..|:.||:.:|:|.||.||.|
  Fly   241 YNNYQAPDGFCFDILCNDAPIIDGKHSPDNNVKERIDTFLDFAKTQSQYYRTNNIIVTMGGDFTY 305

  Fly   259 EDAAVNFKNMDKLIKYVNDRQSTGSQVNVFYSTPSCYLYELHQLKQTWPNKTEDFFPYSSDSHSY 323
            :.|.|.:||:||||:|.|:||:.||.:|:.||||||||..||....|||.|::|||||:||.|:|
  Fly   306 QAAQVYYKNLDKLIRYGNERQANGSNINLLYSTPSCYLKSLHDAGITWPTKSDDFFPYASDPHAY 370

  Fly   324 WTGYFTSRPTQKRFHRDGNHFFQTVKQLSVLANLSGTQYSEDLDNLSQAMGIMQHHDAVTGTEKQ 388
            ||||||||||.|||.||||||.|..||||.||.....::...|..:.:.:||||||||:|||||:
  Fly   371 WTGYFTSRPTLKRFERDGNHFLQVCKQLSALAPKKPEEFDPHLTFMRETLGIMQHHDAITGTEKE 435

  Fly   389 AVASDYDRLLFKAIVGAENSARDALRSLT-----NL--TSG----EFESCLELNISVCAFTQDTA 442
            .||.||.:.:..|......:.|:||..||     |:  ||.    ||::|..|||:.|..::  |
  Fly   436 KVALDYAKRMSVAFRACGATTRNALNQLTVQSKDNVKDTSAKYVFEFKTCALLNITSCPVSE--A 498

  Fly   443 NN-VIVTLVNPLAHSSTQYVRVPAKNENYIVTDEKGREVFSEVVPVPWQVLALEHRPNDTQHELV 506
            |: ..:||.|||||:..:|||:|....||.:.|.||..:.|:.||:|..::.::||.:..::|:|
  Fly   499 NDRFALTLYNPLAHTVNEYVRIPVPYSNYRIIDNKGVTLESQAVPIPQVLIDIKHRNSTAKYEIV 563

  Fly   507 FEAS-----------VDKI----ANFLIRVLPSPKNIAEDQVQFPVERSQDELTVETSLVKLTFD 556
            |.|:           |:|:    .|...:.||              :|:.....:..|.::|.||
  Fly   564 FLATNIPALGYRTYYVEKLDSTEGNTRSKALP--------------KRTSSVTVIGNSHIQLGFD 614

  Fly   557 TTTGGLKTVKMNGFTENIQQTFGIYKGYRGNNGESKNRSSGAYVFRP-YGDIEIVNNKVELSFYN 620
             |.|.|..|..:|.|..:.|.|..|:|..|||.|..|||||||:||| ...|....::||:..|.
  Fly   615 -TNGFLSEVTADGLTRLVSQEFLFYEGAVGNNAEFLNRSSGAYIFRPNENKIHFATDQVEIEVYK 678

  Fly   621 GTKVKEVHQHVNEWISQVIRIYEDVNRVEFEWLVGPIPTDDDVGKEIITRFSSNISSKGKFYTDS 685
            |..|.||||..|:|||||:|:|...:..||||||||||.||.:|||:||||:|:|:|.|.|.|||
  Fly   679 GDLVHEVHQKFNDWISQVVRVYNKDSYAEFEWLVGPIPIDDGIGKEVITRFNSDIASDGIFRTDS 743

  Fly   686 NGREILERERNQREHFTPDMSEAISGNYYPVTGQISLQDDEKRITLLNDRAQGGTSLKDGELELM 750
            ||||:::|:.|.|:.::..::||::|||||:|.:|.::||..|:.:|.||||||:|||||.||||
  Fly   744 NGREMIKRKINHRDTWSVKINEAVAGNYYPITTKIDVEDDTARMAILTDRAQGGSSLKDGSLELM 808

  Fly   751 LHRRLLNDDAFGVGEALNETQYGTGLIARGKIYLIL------DAVDGKPNQRLLQHQLDQHFWKF 809
            :|||||.|||||||||||||:||.|||||||.:|..      :.|..|..:||.|.:.....|||
  Fly   809 VHRRLLKDDAFGVGEALNETEYGDGLIARGKHHLFFGKSTDREGVSLKGIERLTQLEKLLPTWKF 873

  Fly   810 FSKS----------------NGVASVNRNMIPDFFGIPESVELLSLEPYSKDQILIRLENFNTEG 858
            ||..                :|::.|          :|:.|.||:|||:.::|:|:|.|:....|
  Fly   874 FSNMEDYSADEWQTAFTNIFSGISLV----------LPKPVHLLTLEPWHENQLLVRFEHIMENG 928

  Fly   859 ------NVVSFNIYPLFESLDGYQIWETTLDGNMLLEDVKRFKFAQD---------GTGSIPS-- 906
                  ..|.||:..:..:.|...|.|||||||..|::.:|.:||.|         .|.|.|:  
  Fly   929 EDASYSQPVQFNVKNVLSAFDVEGIRETTLDGNAWLDESRRLQFAPDPEEAAFNTYATFSQPAES 993

  Fly   907 -----------SVEY------------------------------------YHAPHNPLTANSTM 924
                       .|:|                                    ...|:|...::|:.
  Fly   994 VHLLSAEKPMLGVKYADEALPAGQLGAESNRIRRETETRQEKKDEGRSSKSTEGPYNSFKSDSSN 1058

  Fly   925 NASGFVVTLVPMQIRTFII 943
            ..  :::.|.||:|||||:
  Fly  1059 QE--YIIELSPMEIRTFIV 1075

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManINP_001260350.1 GH38N_AMII_LAM_like 2..276 CDD:212121 180/276 (65%)
Alpha-mann_mid 323..398 CDD:286360 45/75 (60%)
Glyco_hydro_38C 536..941 CDD:285047 192/492 (39%)
LManIINP_609408.1 GH38N_AMII_LAM_like 47..323 CDD:212121 180/276 (65%)
Alpha-mann_mid 370..445 CDD:214875 45/75 (60%)
Glyco_hydro_38C 502..957 CDD:285047 199/480 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64053993
eggNOG 1 0.900 E1_KOG1959
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 649 1.000 Inparanoid score I165
Isobase 1 0.950 0 Normalized mean entropy S4230
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
orthoMCL 1 0.900 OOG5_129192
Panther 1 1.100 P PTHR11607
RoundUp 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.