DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManI and LManVI

Sequence 1:NP_001260350.1 Gene:LManI FlyBaseID:FBgn0032253 Length:950 Species:Drosophila melanogaster
Sequence 2:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster

Alignment Length:979 Identity:596/980 (61%)
Similarity:737/980 (75%) Gaps:45/980 (5%)


  Fly     1 MINVHLVPHSHDDVGWLKTVDQYYYGSQNKIQHAGVQYILDTVVEELLKDSSRRFIQVETFFFAK 65
            |||:|:|||||||||||||||||:||.::.|||||||||:|||:.||:||.:||||||||.||||
  Fly    37 MINIHMVPHSHDDVGWLKTVDQYFYGHRSNIQHAGVQYIIDTVIAELIKDPARRFIQVETSFFAK 101

  Fly    66 WYSEQTETVQRAVKKLVAQGRLEFAGGAWSMNDEATVHYQSVVDQFNLGLRYLKDTFGDCGRPTV 130
            |::||:||.::.|:|||.:|||||.||||||||||.|:||||:|||.|||::|.||||.|.||.:
  Fly   102 WWAEQSETAKQVVRKLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFTLGLKFLDDTFGSCARPRI 166

  Fly   131 GWQIDPFGHSREMASIFAQMAFNGEFFARMDYVDKKQRMLDLEMEMIWQSSESLKNSNIFTGMLY 195
            ||||||||||||.|||||||.::||||||||:.||..|:.:|.|||||.:|:||.|..||||:||
  Fly   167 GWQIDPFGHSREQASIFAQMGYDGEFFARMDHRDKNDRIDNLGMEMIWDASDSLSNDEIFTGLLY 231

  Fly   196 NHYSAPPGFCFDINCEDAPIIDGESYDNNVDARVSEFIDYVKNMSKSYRSTHIMVPMGDDFQYED 260
            .|||||||:|||::|.|.||||.:||||||.:||.:|:.||.::::.|||.|||:||||||||||
  Fly   232 RHYSAPPGYCFDVHCGDDPIIDTKSYDNNVKSRVDDFLSYVTSVAQHYRSNHIMIPMGDDFQYED 296

  Fly   261 AAVNFKNMDKLIKYVNDRQSTGSQVNVFYSTPSCYLYELHQLKQTWPNKTEDFFPYSSDSHSYWT 325
            |.||||||||||||||:||:.||..|:|||||:|||..||:..|||||||:|||||.||.:||||
  Fly   297 AQVNFKNMDKLIKYVNERQAEGSTFNLFYSTPACYLNSLHEGLQTWPNKTQDFFPYGSDDNSYWT 361

  Fly   326 GYFTSRPTQKRFHRDGNHFFQTVKQLSVLANLSGTQYSEDLDNLSQAMGIMQHHDAVTGTEKQAV 390
            ||||||||||||.|||||..|..|||||.|.|:..|..|||:.|.:.||:||||||:||||||.|
  Fly   362 GYFTSRPTQKRFERDGNHILQVAKQLSVFAELNTKQQKEDLEYLREIMGVMQHHDAITGTEKQHV 426

  Fly   391 ASDYDRLLFKAIVGAENSARDALRSLTNLTSGEFESCLELNISVCAFTQDTANNVIVTLVNPLAH 455
            :.||||:|:.||:|..|:|||.||.||||.:|||||||:||||.||||:|.|:||:|||.|||||
  Fly   427 SDDYDRILYDAILGGVNTARDGLRKLTNLPNGEFESCLQLNISECAFTKDDADNVVVTLYNPLAH 491

  Fly   456 SSTQYVRVPAKNENYIVTDEKGREVFSEVVPVPWQVLALEHRPNDTQHELVFEASVDKIANFLIR 520
            :||||||||.|||||.|||||||.|.||||||.|||||||.|.|||||||||:||||||||:.|:
  Fly   492 TSTQYVRVPVKNENYEVTDEKGRVVASEVVPVAWQVLALEFRNNDTQHELVFKASVDKIANYYIK 556

  Fly   521 VLPS--PKNIA------------EDQVQFP---------------VERSQDELTVETSLVKLTFD 556
            .:.|  .||:|            |..::.|               .:..:.|..|:||.|||..|
  Fly   557 KVASQETKNVAAHTKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDDDEGETVVQTSQVKLVID 621

  Fly   557 TTTGGLKTVKMNGFTENIQQTFGIYKGYRGNNGESKNRSSGAYVFRPY--GDIEIVNNKVELSFY 619
            ..||.||||:|||.:|||.|::|:|:.|          .|||||||.|  .|..:....||.:.|
  Fly   622 NKTGLLKTVEMNGVSENIDQSYGVYRTY----------DSGAYVFRQYHQADFIVQYEGVEFTVY 676

  Fly   620 NGTKVKEVHQHVNEWISQVIRIYEDVNRVEFEWLVGPIPTDDDVGKEIITRFSSNISSKGKFYTD 684
            :|..||||||..:|:|||||||||..|.||.||.||||..:::.|:|::..|:|.|:|.|..|||
  Fly   677 DGALVKEVHQQFSEYISQVIRIYEGKNLVEIEWQVGPIEREEEFGREVVIIFNSTIASDGVSYTD 741

  Fly   685 SNGREILERERNQREHFTPDMS-EAISGNYYPVTGQISLQDDEKRITLLNDRAQGGTSLKDGELE 748
            |||||:::|.::|||.|||.:. :..:.||||||.:|:|||.:|||.:||||||||.|:.:|:||
  Fly   742 SNGREMIKRVKDQRETFTPGLDRQPTAANYYPVTSRIALQDSKKRIAVLNDRAQGGASMLNGQLE 806

  Fly   749 LMLHRRLLNDDAFGVGEALNETQYGTGLIARGKIYLILDAVD-GKPNQRLLQHQLDQHFWKFFSK 812
            |||||||:.||.:||||||||.:||..:|||||:||||...| ....:|..:.::...|||||||
  Fly   807 LMLHRRLVRDDGYGVGEALNEEKYGQPMIARGKVYLILSPSDESTAAEREAEKEIHLPFWKFFSK 871

  Fly   813 SNGVASVNRNMIPDFFGIPESVELLSLEPYSKDQILIRLENF--NTEGNVVSFNIYPLFESLDGY 875
            :.|..:.....:|.|...|:||.||:|||::.|::|:|:|||  :|||.||||||.|:|:.|:|.
  Fly   872 NTGSTTAAAKSVPSFNDFPKSVHLLTLEPFNDDEVLLRVENFLDHTEGQVVSFNIRPIFDYLNGV 936

  Fly   876 QIWETTLDGNMLLEDVKRFKFAQDGTGSIPSSVEYYHAPHNPLTANSTMNASGFVVTLVPMQIRT 940
            :|.|||||||:.|.|:|||||..|.:|..|.:|||:.:.|.||.|..:..||.|.|||.||||||
  Fly   937 EIRETTLDGNLPLSDMKRFKFHHDSSGQKPDAVEYFTSAHKPLAAEQSQEASEFSVTLHPMQIRT 1001

  Fly   941 FIIQ 944
            |||:
  Fly  1002 FIIK 1005

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManINP_001260350.1 GH38N_AMII_LAM_like 2..276 CDD:212121 196/274 (72%)
Alpha-mann_mid 323..398 CDD:286360 52/75 (69%)
Glyco_hydro_38C 536..941 CDD:285047 214/426 (50%)
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 196/274 (72%)
Alpha-mann_mid 359..434 CDD:286360 52/75 (69%)
Glyco_hydro_38C 482..1002 CDD:285047 280/530 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64053783
eggNOG 1 0.900 E1_KOG1959
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 649 1.000 Inparanoid score I165
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
orthoMCL 1 0.900 OOG5_129192
Panther 1 1.100 P PTHR11607
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.