DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManI and LManV

Sequence 1:NP_001260350.1 Gene:LManI FlyBaseID:FBgn0032253 Length:950 Species:Drosophila melanogaster
Sequence 2:NP_001285763.1 Gene:LManV FlyBaseID:FBgn0032068 Length:982 Species:Drosophila melanogaster

Alignment Length:964 Identity:586/965 (61%)
Similarity:734/965 (76%) Gaps:35/965 (4%)


  Fly     1 MINVHLVPHSHDDVGWLKTVDQYYYGSQNKIQHAGVQYILDTVVEELLKDSSRRFIQVETFFFAK 65
            |||:||||||||||||||||||||||.:|.|||||||||:|||:.||:|:..||||||||.||:|
  Fly    36 MINIHLVPHSHDDVGWLKTVDQYYYGHRNNIQHAGVQYIIDTVISELIKNPDRRFIQVETSFFSK 100

  Fly    66 WYSEQTETVQRAVKKLVAQGRLEFAGGAWSMNDEATVHYQSVVDQFNLGLRYLKDTFGDCGRPTV 130
            |::||:||::..||.||.:|||:|..|||||||||.|:||||:|||.:||::|.||||.||||.|
  Fly   101 WWNEQSETMRAVVKMLVNEGRLQFINGAWSMNDEAAVNYQSVIDQFTVGLKFLDDTFGVCGRPRV 165

  Fly   131 GWQIDPFGHSREMASIFAQMAFNGEFFARMDYVDKKQRMLDLEMEMIWQSSESLKNSNIFTGMLY 195
            ||||||||||||.|||:|||.|:||||:|||:.||.:||.||.:||||.:||||....:|||:||
  Fly   166 GWQIDPFGHSREQASIYAQMGFDGEFFSRMDHNDKGRRMNDLALEMIWDASESLSQVKLFTGLLY 230

  Fly   196 NHYSAPPGFCFDINCEDAPIIDGESYDNNVDARVSEFIDYVKNMSKSYRSTHIMVPMGDDFQYED 260
            ..|...||||||::|.|.||||.:||||||.:||.:||.|...:::.:|:.|||:|||.||||||
  Fly   231 TFYWDTPGFCFDVHCSDDPIIDSDSYDNNVKSRVDDFIAYAAQVAEKFRTNHIMIPMGGDFQYED 295

  Fly   261 AAVNFKNMDKLIKYVNDRQSTGSQVNVFYSTPSCYLYELHQLKQTWPNKTEDFFPYSSDSHSYWT 325
            |.||:|||||||||||:|||:||:.|:.||||:|||..:|:..|::||||.|||||.||::|:||
  Fly   296 AEVNYKNMDKLIKYVNERQSSGSKYNIIYSTPTCYLNSVHKSVQSYPNKTLDFFPYGSDTNSFWT 360

  Fly   326 GYFTSRPTQKRFHRDGNHFFQTVKQLSVLANLSGTQYSEDLDNLSQAMGIMQHHDAVTGTEKQAV 390
            ||:|||||||||.|||||..|..||||..|.||.||..|||:.|.:.||:||||||:||||||.|
  Fly   361 GYYTSRPTQKRFERDGNHILQVAKQLSAFAELSSTQQKEDLEYLREIMGVMQHHDAITGTEKQHV 425

  Fly   391 ASDYDRLLFKAIVGAENSARDALRSLTNLTSGEFESCLELNISVCAFTQDTANNVIVTLVNPLAH 455
            :.||||:|:.||||...:|.||||.||||.:|||||||:||||.||||:|.|:||:|||.|.|||
  Fly   426 SDDYDRILYDAIVGGVKTAGDALRKLTNLPNGEFESCLQLNISECAFTKDGADNVVVTLYNALAH 490

  Fly   456 SSTQYVRVPAKNENYIVTDEKGREVFSEVVPVPWQVLALEHRPNDTQHELVFEASVDKIANFLI- 519
            ::.||||||.|||||.|||||||.|.||:||||.:|||||.|.:||||||||:||||||||:.| 
  Fly   491 TTKQYVRVPVKNENYQVTDEKGRVVASEIVPVPAEVLALEFRDSDTQHELVFKASVDKIANYYIK 555

  Fly   520 -----------RVLPSPKNIAEDQVQFPVERSQDELTVETSLVKLTFDTTTGGLKTVKMNGFTEN 573
                       ||:..||..||..       ..:|..|:|||:||..|..||.||.|:|||.:||
  Fly   556 KVDSKESSNGVRVISQPKANAETY-------DDEETIVQTSLIKLVLDNKTGLLKRVEMNGVSEN 613

  Fly   574 IQQTFGIYKGYRGNNGESKNRSSGAYVFRPY--GDIEIVNNKVELSFYNGTKVKEVHQHVNEWIS 636
            |:|::|:|:.|          .|||||||.|  ||..|..:.||.:.|:|..||||||..:|:||
  Fly   614 IEQSYGLYRTY----------DSGAYVFRQYNQGDFVIQEDGVEFTVYDGALVKEVHQRFSEYIS 668

  Fly   637 QVIRIYEDVNRVEFEWLVGPIPTDDDVGKEIITRFSSNISSKGKFYTDSNGREILERERNQREHF 701
            |||||.||...|||||||||||.:::.|.|::|.|||.|:|.|.|||||||||::.||:::||.|
  Fly   669 QVIRISEDKPYVEFEWLVGPIPVEEEFGTEVVTIFSSEIASNGVFYTDSNGRELIRREKDKREDF 733

  Fly   702 TPDMS-EAISGNYYPVTGQISLQDDEKRITLLNDRAQGGTSLKDGELELMLHRRLLNDDAFGVGE 765
            ||::: :..||||||:|.:|:|||..||:.:||||||||||:|||::||||||||:.||.:||||
  Fly   734 TPELAVQPTSGNYYPITSRIALQDSNKRLAILNDRAQGGTSMKDGQIELMLHRRLVRDDGYGVGE 798

  Fly   766 ALNETQYGTGLIARGKIYLILDAVDGKPN-QRLLQHQLDQHFWKFFSKSNGVASVNRNMIPDFFG 829
            ||||.:||..||||||::|||:|.|...: :|..:.:.....||||||:.|..:.....:|.|..
  Fly   799 ALNEEKYGQPLIARGKVFLILNAADESTSAEREAEKEFHLPLWKFFSKNTGSTTAAAKSVPSFDD 863

  Fly   830 IPESVELLSLEPYSKDQILIRLENF--NTEGNVVSFNIYPLFESLDGYQIWETTLDGNMLLEDVK 892
            .|:||.||:|||::.|:||:|:|||  :.||.||||||.|:|:.|:|.:|.|||||||:.|.|:|
  Fly   864 FPKSVHLLTLEPFNDDEILLRVENFKDHIEGKVVSFNIRPIFDYLNGVEIRETTLDGNLPLSDMK 928

  Fly   893 RFKFAQDGTGSIPSSVEYYHAPHNPLTANSTMNASGFVVTLVPMQIRTFIIQQK 946
            :|||..:|:|...|..|||.:.|.||:||.|.:|:.|.|||.|||||||||:.:
  Fly   929 QFKFHAEGSGIRGSEPEYYTSSHKPLSANQTQDAAEFAVTLYPMQIRTFIIKHE 982

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManINP_001260350.1 GH38N_AMII_LAM_like 2..276 CDD:212121 188/274 (69%)
Alpha-mann_mid 323..398 CDD:286360 51/75 (68%)
Glyco_hydro_38C 536..941 CDD:285047 221/411 (54%)
LManVNP_001285763.1 GH38N_AMII_LAM_like 37..311 CDD:212121 188/274 (69%)
Alpha-mann_mid 358..433 CDD:286360 51/75 (68%)
Glyco_hydro_38C 481..977 CDD:285047 282/513 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64053691
eggNOG 1 0.900 E1_KOG1959
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 649 1.000 Inparanoid score I165
Isobase 1 0.950 0 Normalized mean entropy S4230
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
orthoMCL 1 0.900 OOG5_129192
Panther 1 1.100 P PTHR11607
RoundUp 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.