DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManI and LManIV

Sequence 1:NP_001260350.1 Gene:LManI FlyBaseID:FBgn0032253 Length:950 Species:Drosophila melanogaster
Sequence 2:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster

Alignment Length:956 Identity:596/957 (62%)
Similarity:733/957 (77%) Gaps:28/957 (3%)


  Fly     1 MINVHLVPHSHDDVGWLKTVDQYYYGSQNKIQHAGVQYILDTVVEELLKDSSRRFIQVETFFFAK 65
            |:|:|||||||:||||||||||.|||.:|||.|||||||||:||.:||:|..||||||||.||||
  Fly    37 MVNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGVQYILDSVVSQLLQDPKRRFIQVETAFFAK 101

  Fly    66 WYSEQTETVQRAVKKLVAQGRLEFAGGAWSMNDEATVHYQSVVDQFNLGLRYLKDTFGDCGRPTV 130
            |::.|:|::::.|.|||.:||.||.||||||||||.|:||.|:|||.:||::|.:|||.||||.|
  Fly   102 WWNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEANVNYQGVIDQFTVGLKFLNETFGSCGRPRV 166

  Fly   131 GWQIDPFGHSREMASIFAQMAFNGEFFARMDYVDKKQRMLDLEMEMIWQSSESLKNSNIFTGMLY 195
            |||||.||||||.|:|||.|.::|:||:|||:.||..||.||.|||||.:|||:...::|:||||
  Fly   167 GWQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKDTRMNDLTMEMIWDASESMSGVSLFSGMLY 231

  Fly   196 NHYSAPPGFCFDINCEDAPIIDGESYDNNVDARVSEFIDYVKNMSKSYRSTHIMVPMGDDFQYED 260
            |.||..|||||||.|.|.|||||:|.:|||..||.:||.|.||:|:.|.:.|||||||.||||||
  Fly   232 NFYSDTPGFCFDILCTDQPIIDGDSEENNVKQRVDDFISYAKNVSEVYITNHIMVPMGGDFQYED 296

  Fly   261 AAVNFKNMDKLIKYVNDRQSTGSQVNVFYSTPSCYLYELHQLKQTWPNKTEDFFPYSSDSHSYWT 325
            |.||:|||||||||:|:||::||:.|:|||||||||..|||..::|||||:|||||:.:.:|:||
  Fly   297 AKVNYKNMDKLIKYINERQASGSKYNIFYSTPSCYLNSLHQSLESWPNKTQDFFPYAHEKNSFWT 361

  Fly   326 GYFTSRPTQKRFHRDGNHFFQTVKQLSVLANLSGTQYSEDLDNLSQAMGIMQHHDAVTGTEKQAV 390
            |:||||||||||.|||||..|..|||||||||:..::..|||.|.|.||:||||||:||||||||
  Fly   362 GFFTSRPTQKRFERDGNHMLQVAKQLSVLANLTSEEHKIDLDYLRQVMGVMQHHDAITGTEKQAV 426

  Fly   391 ASDYDRLLFKAIVGAENSARDALRSLTNLTSGEFESCLELNISVCAFTQDTANNVIVTLVNPLAH 455
            :.||||::::|||||.|:||||||.|||:..|||||||.||||.||||:|.|:||:|||.|||||
  Fly   427 SDDYDRMMYEAIVGASNNARDALRLLTNMPYGEFESCLRLNISECAFTKDGADNVLVTLYNPLAH 491

  Fly   456 SSTQYVRVPAKNENYIVTDEKGREVFSEVVPVPWQVLALEHRPNDTQHELVFEASVDKIANFLIR 520
            |||||||:|.|.|||.|||||||.|.||||||||||||||:|.|||||||||:|:|:|::::.| 
  Fly   492 SSTQYVRIPVKEENYQVTDEKGRTVPSEVVPVPWQVLALEYRSNDTQHELVFKATVNKVSSYSI- 555

  Fly   521 VLPSPKNIAEDQVQF-------PVERSQDELTVETSLVKLTFDTTTGGLKTVKMNGFTENIQQTF 578
                 |.:...:|:.       |.|.:..|..||.|:|||..|..||.||:|:|||.:|.|.|.|
  Fly   556 -----KKVESSEVKHSSIKKINPREDNNSETVVENSVVKLVMDNHTGRLKSVEMNGVSEKIVQNF 615

  Fly   579 GIYKGYRGNNGESKNRSSGAYVFRPYGDIEIVNNKVELSFYNGTKVKEVHQHVNEWISQVIRIYE 643
            |:||.:          :|.||.||..||||:..|..|.:.|.|:.|||||||||:||||||||||
  Fly   616 GVYKSH----------TSCAYTFRQDGDIELFENDFEFTVYEGSLVKEVHQHVNDWISQVIRIYE 670

  Fly   644 DVNRVEFEWLVGPIPTDDDVGKEIITRFSSNISSKGKFYTDSNGREILERERNQREHFTPDMS-E 707
            .|:|||.||:|||||.||.:|.|.:|.|.|.|||.|.|||||||||:::|.:::||.|..|:| :
  Fly   671 GVSRVELEWMVGPIPIDDKLGSEFVTNFKSEISSNGVFYTDSNGRELMKRVKDKREDFVSDLSRQ 735

  Fly   708 AISGNYYPVTGQISLQDDEKRITLLNDRAQGGTSLKDGELELMLHRRLLNDDAFGVGEALNETQY 772
            .:|||:||||.:|:||||.||:.|||||:|||.||:||.||:::|||.|.:|..|||||||||||
  Fly   736 PVSGNFYPVTSRIALQDDTKRLVLLNDRSQGGASLEDGALEMLIHRRHLFNDGGGVGEALNETQY 800

  Fly   773 GTGLIARGKIYLILD-AVDGKP-NQRLLQHQLDQHFWKFFSKSNGVASVNRNMIPDFFGIPESVE 835
            |.|||||||:||||| |.||.. .:|..:.:|...|||||||:.||.......:|||..:|:||.
  Fly   801 GKGLIARGKLYLILDSATDGDTVTERKTEKELFLPFWKFFSKTGGVEITPSKSLPDFNDLPQSVH 865

  Fly   836 LLSLEPYSKDQILIRLENF--NTEGNVVSFNIYPLFESLDGYQIWETTLDGNMLLEDVKRFKFAQ 898
            ||:||.:|:.:||||.|:|  .:||.|:||||..:|:||.|..|.||||||||.|.|:|||||..
  Fly   866 LLTLEFFSEQEILIRFEHFLDKSEGRVISFNIRDIFDSLGGLAIRETTLDGNMPLSDMKRFKFHA 930

  Fly   899 DGTGSIPSSVEYYHAPHNPLTANSTMNASGFVVTLVPMQIRTFIIQ 944
            ..:|:.||||||..|.|.||.|..:..||.|.|||.|||||||||:
  Fly   931 QESGTKPSSVEYSTAQHKPLEAVKSDEASLFAVTLYPMQIRTFIIK 976

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManINP_001260350.1 GH38N_AMII_LAM_like 2..276 CDD:212121 185/274 (68%)
Alpha-mann_mid 323..398 CDD:286360 53/75 (71%)
Glyco_hydro_38C 536..941 CDD:285047 233/410 (57%)
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 185/273 (68%)
Alpha-mann_mid 359..434 CDD:214875 53/75 (71%)
Glyco_hydro_38C 483..973 CDD:285047 291/506 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64053740
eggNOG 1 0.900 E1_KOG1959
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 649 1.000 Inparanoid score I165
Isobase 1 0.950 0 Normalized mean entropy S4230
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11607
RoundUp 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.