DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManI and MAN2B2

Sequence 1:NP_001260350.1 Gene:LManI FlyBaseID:FBgn0032253 Length:950 Species:Drosophila melanogaster
Sequence 2:NP_056089.1 Gene:MAN2B2 HGNCID:29623 Length:1009 Species:Homo sapiens

Alignment Length:1062 Identity:275/1063 (26%)
Similarity:450/1063 (42%) Gaps:196/1063 (18%)


  Fly     2 INVHLVPHSHDDVGWLKTVDQYYYGSQNKIQHAGVQYILDTVVEELLKDSSRRFIQVETFFFAKW 66
            |...:|||||.||||:.||.:        ...|....:..:|||||.:...||||.||..||..|
Human    27 IRAFVVPHSHMDVGWVYTVQE--------SMRAYAANVYTSVVEELARGQQRRFIAVEQEFFRLW 83

  Fly    67 YSEQTETVQR-AVKKLVAQGRLEFAGGAWSMNDEATVHYQSVVDQFNLGLRYLKDTFGDCGRPTV 130
            :.......|: .|::|:.:|||||..|...|:|||..|....:.|...|..:|.:|||.  ||..
Human    84 WDGVASDQQKYQVRQLLEEGRLEFVIGGQVMHDEAVTHLDDQILQLTEGHGFLYETFGI--RPQF 146

  Fly   131 GWQIDPFGHSREMASIFAQMAFNGEFFARMDYVDKKQRMLDLE-MEMIWQSSESL-KNSNIFTGM 193
            .|.:||||.|....::||...||....:|:|| |.|..|.:.. ::.:|:.|.|| :...|||.:
Human   147 SWHVDPFGASATTPTLFALAGFNAHLGSRIDY-DLKAAMQEARGLQFVWRGSPSLSERQEIFTHI 210

  Fly   194 L--YNH-------YSAPPGFCFD-INCEDAPIIDGESYDN--------NVDARVSEFIDYVKNMS 240
            :  |::       :|...||.:: :.....|..|| .|.|        |::......:..||..:
Human   211 MDQYSYCTPSHIPFSNRSGFYWNGVAVFPKPPQDG-VYPNMSEPVTPANINLYAEALVANVKQRA 274

  Fly   241 KSYRSTHIMVPMGDDFQYEDAAVNFKNMDKLIKYVNDRQSTGSQVNVFYSTPSCYLYELHQLKQT 305
            ..:|:.|::.|.|.|.|:.:|:|.|.|||.|:.::|. .:....|:|.|:|...|...||.|..|
Human   275 AWFRTPHVLWPWGCDKQFFNASVQFANMDPLLDHINS-HAAELGVSVQYATLGDYFRALHALNVT 338

  Fly   306 WPNKT-EDFFPYSSDSHSYWTGYFTSRPTQKRFHR-------DGNHFFQTVKQLSVLANLSGTQY 362
            |..:. .||.|||::....|||::|||.:.|...|       .|...|......:...:|..|..
Human   339 WRVRDHHDFLPYSTEPFQAWTGFYTSRSSLKGLARRASALLYAGESMFTRYLWPAPRGHLDPTWA 403

  Fly   363 SEDLDNLSQAMGIMQHHDAVTGTEKQAVASDYDRLLFKAIVGAENSARDALRSLTNLTSGEFESC 427
            .:.|..|..|:..:|||||:||||...|...|...|...::|..       :.:.::...|    
Human   404 LQQLQQLRWAVSEVQHHDAITGTESPKVRDMYATHLASGMLGMR-------KLMASIVLDE---- 457

  Fly   428 LELNISVCAFTQDTANNVIVTLVNPLAHSSTQYVRVPAKNENYIVTDEKGREVFSEVVPVPWQVL 492
            |:....:.|.:.........::.||||.:.|..|.:........||||.|.       |||.|:.
Human   458 LQPQAPMAASSDAGPAGHFASVYNPLAWTVTTIVTLTVGFPGVRVTDEAGH-------PVPSQIQ 515

  Fly   493 ALEHRPNDTQHELVFEASVDKIA--NFLIRVLPSPKNIAEDQVQFPVERSQDELTVETSLVKLT- 554
            .....|  :.::|:...::..::  ::.||    |...|::..|.|.......|.....|.:.| 
Human   516 NSTETP--SAYDLLILTTIPGLSYRHYNIR----PTAGAQEGTQEPAATVASTLQFGRRLRRRTS 574

  Fly   555 -----------------FDTTTGGLKTV--KMNGFTENIQQTFGIYKGYRGNNGESKNRSSGAYV 600
                             .|..|..:.::  :.:..|..:.|.|   ..|..|....:...|..|:
Human   575 HAGRYLVPVANDCYIVLLDQDTNLMHSIWERQSNRTVRVTQEF---LEYHVNGDVKQGPISDNYL 636

  Fly   601 FRPYGDIEIVNNKVELSFYNGTKVKEVHQH-------------VNEWISQVIRIYED---VNRVE 649
            |.|..........||:....|..|.|:.|:             :...::.|.:.::.   .:|:|
Human   637 FTPGKAAVPAWEAVEMEIVAGQLVTEIRQYFYRNMTAQNYTYAIRSRLTHVPQGHDGELLCHRIE 701

  Fly   650 FEWLVGPIPTDDDVGKEIITRFSSNISSKGKFYTDSNGREILERERNQREHFTPDMSEAISGNYY 714
            .|:..||:    ::.:|.:.|.|:|::|:...|:|:||.::      ||..:...::.:|:.|||
Human   702 QEYQAGPL----ELNREAVLRTSTNLNSQQVIYSDNNGYQM------QRRPYVSYVNNSIARNYY 756

  Fly   715 PVTGQISLQDDEKRITLLNDRAQGGTSLKDGELELMLHRRLLN--DDAFGVGEALNETQYGTGLI 777
            |:.....::|.:.|:.||::||.|.:|..:|::|:||||||.|  |...|....||:|.     :
Human   757 PMVQSAFMEDGKSRLVLLSERAHGISSQGNGQVEVMLHRRLWNNFDWDLGYNLTLNDTS-----V 816

  Fly   778 ARGKIYLILD--AVDGKPNQR---LLQHQLDQHFWKFFSKSNGVASVNRNMIPDFFGIPESVELL 837
            ....::|:|.  ::.....||   .|||:.    ...|....|.|       |...| |:..|.:
Human   817 VHPVLWLLLGSWSLTTALRQRSALALQHRP----VVLFGDLAGTA-------PKLPG-PQQQEAV 869

  Fly   838 SLEP-------------YSKD---------------------QILIRLENFNTEG------NVVS 862
            :|.|             ||.:                     ::|:||.:....|      ..|:
Human   870 TLPPNLHLQILSIPGWRYSSNHTEHSQNLRKGHRGEAQADLRRVLLRLYHLYEVGEDPVLSQPVT 934

  Fly   863 FNIYPLFESLDG-YQIWETTLDGNMLLEDVKRFKFAQDGTGSIPSSVEYYHAPHNPLTANSTMNA 926
            .|:..:.::|.. ..:.|.:|.|...|..:.|:.: :.|.|.           |...|.:.:...
Human   935 VNLEAVLQALGSVVAVEERSLTGTWDLSMLHRWSW-RTGPGR-----------HRGDTTSPSRPP 987

  Fly   927 SGFVVTLVPMQIRTFII--QQK 946
            .|.::|:.|.:||||.|  ||:
Human   988 GGPIITVHPKEIRTFFIHFQQQ 1009

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManINP_001260350.1 GH38N_AMII_LAM_like 2..276 CDD:212121 97/295 (33%)
Alpha-mann_mid 323..398 CDD:286360 26/82 (32%)
Glyco_hydro_38C 536..941 CDD:285047 105/489 (21%)
MAN2B2NP_056089.1 GH38N_AMII_Epman_like 27..352 CDD:212122 113/338 (33%)
Alpha-mann_mid 358..439 CDD:214875 26/81 (32%)
Glyco_hydro_38C 581..1002 CDD:285047 101/463 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11607
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.