DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManI and man2a2

Sequence 1:NP_001260350.1 Gene:LManI FlyBaseID:FBgn0032253 Length:950 Species:Drosophila melanogaster
Sequence 2:XP_009296075.1 Gene:man2a2 ZFINID:ZDB-GENE-110331-1 Length:1174 Species:Danio rerio

Alignment Length:1110 Identity:288/1111 (26%)
Similarity:450/1111 (41%) Gaps:276/1111 (25%)


  Fly     2 INVHLVPHSHDDVGWLKTVDQYYYGSQNKIQHAGVQYILDTVVEELLKDSSRRFIQVETFFFAKW 66
            :.|.:|||||:|.||:||.|:||   .::.||     ||:.:|.::.:|..|:||..|..:||||
Zfish   166 LQVFVVPHSHNDPGWIKTFDKYY---NDQTQH-----ILNNMVTKMAEDPRRKFIWSEISYFAKW 222

  Fly    67 YSEQTETVQRAVKKLVAQGRLEFAGGAWSMNDEATVHYQSVVDQFNLGLRYLKDTFGDCGRPTVG 131
            :.......|..::||:..|:||...|.|.|.|||..||.:::||...|.::|:...|  ..|..|
Zfish   223 WESADVHKQEVMRKLILSGQLEMVTGGWVMTDEANAHYFAMIDQLIEGHQWLERNLG--VTPRSG 285

  Fly   132 WQIDPFGHSREMASIFAQMAFNGEFFARMDYVDKKQRMLDLEMEMIWQSSESLKNS-NIFTGML- 194
            |.:||||||..|..:..:...:.....|:.|..||.......:|.:|:.:..:::| ::|..|: 
Zfish   286 WAVDPFGHSATMPYLLKRANISSMLIQRVHYSIKKHFAATRSLEFMWRQAWDIESSTDMFCHMMP 350

  Fly   195 YNHYSAP------PGFC--FD--------INCEDAP--IIDGESYDNNVDARVSEFIDYVKNMSK 241
            :..|..|      |..|  ||        :||   |  :......|.||..|....:|..:..||
Zfish   351 FYSYDVPHTCGPDPKICCQFDFKRLPGSRVNC---PWKVPPRAINDANVAERAGVLLDQYRKKSK 412

  Fly   242 SYRSTHIMVPMGDDFQYEDAA---VNFKNMDKLIKYVNDRQSTGSQVNVFYSTPSCYLYELHQLK 303
            .:||..::||:||||:|:.|.   ..:.|..||..|:|....  ..|...::|.|.|...:::..
Zfish   413 LFRSKVLLVPLGDDFRYDKALEWDQQYLNYQKLFDYMNSHPE--MHVKAQFATLSDYFDAVYKAN 475

  Fly   304 --------QTWPNKTEDFFPYSSDSHSYWTGYFTSRPTQKRFHRDGNHFFQTVKQLSVL------ 354
                    ..:|..:.|||.|:.....||:||:||||..|...|......:..:.|..|      
Zfish   476 GVTSGARPPDYPVLSGDFFAYADREDHYWSGYYTSRPFYKNLDRILESHLRGAEILYSLAVAHAR 540

  Fly   355 -ANLSGTQYSEDLDNLSQA---MGIMQHHDAVTGTEKQAVASDYDRLLFKAIVGAE----NSA-- 409
             |.:.|.....|...|:.|   :|:.|||||:|||.|:||..||...|.:::||.:    |:|  
Zfish   541 HAGVEGRYPVSDYSLLTDARRNIGLFQHHDAITGTAKEAVVIDYGNRLLRSLVGLKRVIINAAHF 605

  Fly   410 -----RDALR------------------SLTNLTSGEFESCLELNISVCAFTQDTANNVIVTLVN 451
                 :|..|                  ||...|..|.||                :...:.|.|
Zfish   606 LIIKNKDIYRFYQTEPFLETDDRRATQDSLPQRTLIELES----------------SPRYLVLFN 654

  Fly   452 PLAHSSTQYVRVPAKNENYIVTDEKGREVFSEVVPVPWQVLALEHRPNDTQHELVFEASVDKIAN 516
            |:.......|.|...:....|..|.|:       .:|.|:.|......:...| |::||      
Zfish   655 PVEQERLCLVTVLVNSARVRVLTEDGQ-------TLPVQLSAQWMSATEMSGE-VYQAS------ 705

  Fly   517 FLIRVLP--------------SPKNI-AEDQVQFPVE----RSQDELTVETSLV----------- 551
            |:.| ||              ||..: :|..::.|..    |..|.|.|.:..|           
Zfish   706 FMAR-LPALGLAVFHLYDSADSPMTLRSETLLRVPGRGQSIRGLDPLPVRSQTVDGQPFYIQSQS 769

  Fly   552 -KLTFDTTTGGLKTVKMNGFTE--NIQQTFGIYKGYRGNNGESKNRSSGAYVFRPYGDIEIVNNK 613
             .|.|...||.|::::.....:  .:|..|..| |.|    .||:: ||||:|.|.|:.:..:.:
Zfish   770 LTLGFSGATGLLESIRRKDDPQEVRVQIQFLTY-GTR----PSKDK-SGAYLFLPDGNAKPYSQR 828

  Fly   614 VE--LSFYNGTKVKEVHQHVNEWISQVIRIYE--DVNRVEFEWLVGPIPTDDDVGKEIITRFSSN 674
            ..  :....|....||..|...: .|.:||:.  .|:.:..: :...:...|...||:..||.::
Zfish   829 EAPIVRVVEGPLFAEVVAHYQHF-QQTVRIHNVPGVDGLSLD-ITTMVDIRDQNNKELAMRFVTD 891

  Fly   675 ISSKGKFYTDSNGREILERERNQREHFTPDMSEAISGNYYPVTGQISLQDDEKRITLLNDRAQGG 739
            |.|...||||.||.:|..|...|:   .|     :..|:||:.....:||.:.|:||...:|.|.
Zfish   892 IQSGDTFYTDLNGFQIQPRRYFQK---LP-----LQANFYPMPSTAYIQDSQYRLTLHTAQALGV 948

  Fly   740 TSLKDGELELMLHRRLLNDDAFGVGEALNETQ----------------------YG-------TG 775
            |||..|:||::|.|||:.||..|:|:.|.:.:                      |.       .|
Zfish   949 TSLASGQLEVILDRRLMQDDNRGLGQGLKDNKRTANRFRLLLERRSNSAKPAGSYANMLNKIIAG 1013

  Fly   776 LIARGKIYLILDAVDGKP----------NQRLLQHQLDQHFWKFFSKSNGVASVNRNMIPDFFGI 830
            ::..|:    .:.||.:|          ...:|.|::  .......:.:||..: |...|....:
Zfish  1014 ILGDGQ----EEPVDSRPVSFPSLLSHMTSTILNHEV--LALPVLPRKHGVPPM-RTFAPLAGTL 1071

  Fly   831 PESVELLSLEPYSKDQ-----------ILIRL----------ENFN---TEGNVVSFNIYPLFES 871
            |....||:|......|           :|.||          ..||   |:|.:   ::..||..
Zfish  1072 PCDFHLLNLRSIQSPQDAHSPSPYMALLLHRLGLDCGLEPQNPGFNCTTTQGQL---SVSGLFRG 1133

  Fly   872 LDGYQIWETTLDGNMLLEDVKRFKFAQDGTGSIPSSVEYYHAPHNPLTANSTMNASGFVVTLVPM 936
            ||           ..||:               |.|:...|: ..||:.:|:       |:|.||
Zfish  1134 LD-----------LQLLQ---------------PMSLSLMHS-QPPLSNDSS-------VSLEPM 1164

  Fly   937 QIRTF 941
            :|..:
Zfish  1165 EISAY 1169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManINP_001260350.1 GH38N_AMII_LAM_like 2..276 CDD:212121 96/297 (32%)
Alpha-mann_mid 323..398 CDD:286360 31/85 (36%)
Glyco_hydro_38C 536..941 CDD:285047 116/490 (24%)
man2a2XP_009296075.1 PLN02701 128..1173 CDD:178304 288/1111 (26%)
CE4_SF 165..508 CDD:301698 110/357 (31%)
Alpha-mann_mid 503..588 CDD:214875 31/85 (36%)
Glyco_hydro_38C 741..1169 CDD:285047 115/488 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.