DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManI and man2b2

Sequence 1:NP_001260350.1 Gene:LManI FlyBaseID:FBgn0032253 Length:950 Species:Drosophila melanogaster
Sequence 2:NP_001106515.1 Gene:man2b2 XenbaseID:XB-GENE-1006292 Length:990 Species:Xenopus tropicalis

Alignment Length:1058 Identity:284/1059 (27%)
Similarity:449/1059 (42%) Gaps:208/1059 (20%)


  Fly     2 INVHLVPHSHDDVGWLKTVDQYYYGSQNKIQHAGVQYILDTVVEELLKDSSRRFIQVETFFFAKW 66
            |...::||||.||||:.||.:        ..||....:..||||||::...||||.||..||..|
 Frog    22 IQAFVIPHSHMDVGWVYTVQE--------SMHAYAANVYTTVVEELMRGDRRRFIVVEQEFFRLW 78

  Fly    67 YSEQTETVQR-AVKKLVAQGRLEFAGGAWSMNDEATVHYQSVVDQFNLGLRYLKDTFGDCGRPTV 130
            :......|:: .|.:|:.:|||||..|...|:|||.......:.|...|..::.:|||  .||..
 Frog    79 WKLFAGNVEKQQVHQLMREGRLEFVIGGQVMHDEALTTIDDQILQLTEGHGFIYETFG--VRPRF 141

  Fly   131 GWQIDPFGHSREMASIFAQMAFNGEFFARMDYVDKKQRMLDLEMEMIWQSSESLKN-SNIFTGML 194
            .|.:||||.|....::||...|||...:|:||..|.......|::.||::|.||.: ..|||.::
 Frog   142 SWHVDPFGASAASPTLFAMAGFNGHLISRIDYDTKADMQNGKELQFIWRASPSLSDKQEIFTHVM 206

  Fly   195 ---------YNHYSAPPGFCFD-INCEDAPIIDGESYDNNVDARVSEFIDYVKNMSKS------- 242
                     |..:|...||.:: |.....|..||...:.::.........|.:.|.|:       
 Frog   207 DQYSYCTPSYIPFSDRSGFYWNGIAVFPDPPKDGMYPNMSLPVTADTIHPYAETMVKNIKERAAW 271

  Fly   243 YRSTHIMVPMGDDFQYEDAAVNFKNMDKLIKYVNDRQSTGSQVNVFYSTPSCYLYELHQLKQTWP 307
            :||:.::.|.|.|.|:.:|:|.|.|||.|:.|:|.....|  |.|.|||...|...|:....||.
 Frog   272 FRSSDVLWPWGCDKQFFNASVQFNNMDLLLDYINKHTEFG--VTVQYSTLGDYFKNLYNRNLTWG 334

  Fly   308 NK-TEDFFPYSSDSHSYWTGYFTSRPTQKRFHRDGNHFFQTVKQL---SVLANLSGTQYS----E 364
            .: ::||.||||||...|||::|||...|...|..:......:..   .:|.:.:|:...    |
 Frog   335 LRGSQDFLPYSSDSSQAWTGFYTSRNVLKGVARRASSLLYAAESAFAQHLLKHPTGSVEKVWAME 399

  Fly   365 DLDNLSQAMGIMQHHDAVTGTEKQAVASDYDRLLFKAIVGAENSARDALRSLT-NLTSGEFESCL 428
            .|.:|..|:..:||||.:||||...|...|...|.:...|    .|..:.::. :|.|.:..|| 
 Frog   400 QLRSLRWAVSEVQHHDGITGTESPKVRDMYIANLLQGAAG----VRKLMAAIVMDLYSSQANSC- 459

  Fly   429 ELNISVCAFTQDTANNVI-VTLVNPLAHSSTQYVRVPAKNENYIVTDEKGREVFSEVVPVPWQVL 492
                         .|..| :|:.||||...|.:|.||..|....|.|:.|:       |||.|: 
 Frog   460 -------------GNGYINITVYNPLAWDVTTFVLVPMNNSVSGVYDKFGQ-------PVPAQI- 503

  Fly   493 ALEHRPNDTQHELVFEASVDKIANFLIRVLPSPKNIAEDQVQFPV---ERSQDELTVETSLVKLT 554
                 .|.|:....|:          :.:|.:.|.::..:....:   :.:.|.|....   |:|
 Frog   504 -----QNATEPSNAFD----------LHILVTLKGLSYGRYSIKLGSCDAANDRLVTGR---KIT 550

  Fly   555 F---------------------------DTTTGGLKTVKMNGFTENIQQTFGIYKGYRGNNGESK 592
            |                           |..|..|.::......:.:|.|....: |..|...||
 Frog   551 FVRQPKRNKAKRQNLVTPIMNDCYTVVIDQNTNLLHSITARESNQTVQVTQEFLE-YHSNGDISK 614

  Fly   593 NRSSGAYVFRPYGDIEIVNNKVELSFYNGTKVKEVHQHVNEWISQVIRIYEDVNR---------- 647
            ...|..|:|...|........|.|....|..|.|:.|:....|:....:|...:|          
 Frog   615 GPISDNYLFTSTGPAISAYKAVGLEIIAGKLVTEIRQYFYSNITAQTYLYAVYSRIYNVPEGYDK 679

  Fly   648 ------VEFEWLVGPIPTDDDVGKEIITRFSSNISSKGKFYTDSNGREILERERNQREHFTPDMS 706
                  :|..:.|||:    |:.:|.|.|.|:::.:....|||:||.::      ||..|....:
 Frog   680 SLVCHHIEQSYRVGPM----DLNRESIIRTSTDLRTDRLIYTDNNGYQM------QRRQFKNYDT 734

  Fly   707 EAISGNYYPVTGQISLQDDEKRITLLNDRAQGGTSLKDGELELMLHRRLLNDDAFGVGE--ALNE 769
            ..::.||||:.....::|:..|:..|::||.|.:|..:||:|:||||||.|:..:.:..  .||:
 Frog   735 NTVARNYYPMVRTAYIEDNSTRLVFLSERAHGVSSQDNGEVEIMLHRRLWNNLEWDLNYNLTLND 799

  Fly   770 TQYGTGLIARGKIYLILD--AVDGKPNQRL---LQHQLDQHFWKFFSKSNG--VASVNRNMIPDF 827
            |.     :.|..|:|:|.  |:.|...|||   |:|:.    ...:|...|  ..|.....:|  
 Frog   800 TS-----VVRPTIWLMLGSRALAGALYQRLGMALEHRP----LVIYSLHTGQEKRSYKTTDLP-- 853

  Fly   828 FGIPESV--ELLSLEP--YSK---------------------DQILIRLEN-FNTE-----GNVV 861
            ..:|:::  ::||:..  ||.                     .::|:||:: :.|.     ...|
 Frog   854 ITLPDNIHLQILSIPGWFYSSRHHEHMQDIHTGNIRDNVADFHRVLLRLQHLYETNEDPVLSKPV 918

  Fly   862 SFNIYPLFESLDGYQ-IWETTLDGNMLLEDVKRFKFAQDGTGSIPSSVEYYHAPHNPLTANSTMN 925
            :.|:..|.:.|.... :.|.:|.|...:..:||:|:    ..:|..:.:..|          |:.
 Frog   919 TINLQSLLKGLGTVSLVEERSLTGTWDIHTLKRWKW----KANIKGTDQREH----------TLG 969

  Fly   926 ASGFVVTLVPMQIRTFII 943
            .|.|.:||.|.:|||..:
 Frog   970 TSDFTITLSPKEIRTLFV 987

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManINP_001260350.1 GH38N_AMII_LAM_like 2..276 CDD:212121 97/293 (33%)
Alpha-mann_mid 323..398 CDD:286360 24/82 (29%)
Glyco_hydro_38C 536..941 CDD:285047 113/492 (23%)
man2b2NP_001106515.1 GH38N_AMII_Epman_like 22..346 CDD:212122 113/336 (34%)
Alpha-mann_mid 352..433 CDD:214875 24/81 (30%)
Glyco_hydro_38C 567..985 CDD:285047 108/454 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.