DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManI and man2a1

Sequence 1:NP_001260350.1 Gene:LManI FlyBaseID:FBgn0032253 Length:950 Species:Drosophila melanogaster
Sequence 2:NP_001163963.1 Gene:man2a1 XenbaseID:XB-GENE-961025 Length:1150 Species:Xenopus tropicalis

Alignment Length:1074 Identity:294/1075 (27%)
Similarity:475/1075 (44%) Gaps:224/1075 (21%)


  Fly     2 INVHLVPHSHDDVGWLKTVDQYYYGSQNKIQHAGVQYILDTVVEELLKDSSRRFIQVETFFFAKW 66
            :.|.||||||:|.|||||.|.|:   :::.||     ||:.:|.:|.:|.:|:|:..|..:|:||
 Frog   168 LQVFLVPHSHNDPGWLKTFDDYF---RDQTQH-----ILNNMVIKLQEDKNRKFMWSEISYFSKW 224

  Fly    67 YSEQTETVQRAVKKLVAQGRLEFAGGAWSMNDEATVHYQSVVDQFNLGLRYLKDTFGDCGRPTVG 131
            :.......:.|||:|:...:.|...|.|.|.||||.||.|:|||...|.::|:...|  .:|..|
 Frog   225 WDGIDNQKKEAVKRLIELEQFEIVTGGWVMPDEATPHYFSLVDQLIEGHQWLEKNLG--VKPKSG 287

  Fly   132 WQIDPFGHSREMASIFAQMAFNGEFFARMDYVDKKQRMLDLEMEMIWQSSESLKNS-NIFTGML- 194
            |.|||||||..||.|......:.....|:.|..||.......:|..|:.:..|.:| :|...|: 
 Frog   288 WAIDPFGHSPTMAYILKSSGLSNMLIQRVHYSIKKYFASKQTLEFFWRQNWDLGHSTDILCHMMP 352

  Fly   195 YNHYSAP------PGFC--FD--------INCE---DAPIIDGESYDNNVDARVSEFIDYVKNMS 240
            :..|..|      |..|  ||        ::|.   ...:|:    :.||..|....:|..:..|
 Frog   353 FYSYDVPHTCGPDPKICCQFDFKRLPGSRVSCPWRVPPEVIN----EGNVQHRAWMILDQYRKKS 413

  Fly   241 KSYRSTHIMVPMGDDFQYEDAA---VNFKNMDKLIKYVNDRQSTGSQVNVFYSTPSCYLYELHQL 302
            |.||:..::||:||||:|.|:.   ..::|..||..|:|.....  .|...:.|.|.|...|.:.
 Frog   414 KLYRTKVLLVPLGDDFRYTDSLEWDQQYENYQKLFSYMNSHPEL--HVKAQFGTISDYFKALRKA 476

  Fly   303 -------KQTWPNKTEDFFPYSSDSHSYWTGYFTSRPTQKRFHR---------DGNHFFQTVK-- 349
                   .|::|..:.|||.|:.....||:|||||||..||..|         :..:.|..|:  
 Frog   477 GNVDDPNSQSFPVLSGDFFTYADRDDHYWSGYFTSRPFYKRLERVMESHLRAAEILYSFALVQMN 541

  Fly   350 QLSVLANLSGTQYSEDLDNLSQAMGIMQHHDAVTGTEKQAVASDYDRLLFKAIVGAENSARDALR 414
            :...|.:....::.:.|....:.:|:.|||||:|||.|..|..||...||.:::..:....||..
 Frog   542 KFDKLQSFPSVEHYKLLTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFHSLMNLKRVIIDAAH 606

  Fly   415 SLT---------NLTSGEFESCLELNISVCAFTQDTANNV-----IVTLVNPLAHSSTQYVRVPA 465
            .|.         | .|..|.|..::..|..:..|.|...:     .:|:.||........|.|..
 Frog   607 VLVLKDKDTYAYN-PSSPFFSMDDVQPSQDSLPQKTVIKITEIPRYLTVYNPTEQERYSVVSVYV 670

  Fly   466 KNENYIVTDEKGREVFSEVVPVPW-----------QVLALEHRP--NDTQHELVFEASVDKI-AN 516
            .:....|....|:.:.:::..| |           ||..|.:.|  ....::||...:.:.| |:
 Frog   671 SSSKVKVISASGKALKAQISAV-WNGDSAPLQDMYQVSFLAYLPALGLAVYKLVEAENSESIKAD 734

  Fly   517 FLIRVLPSPKNIAED------QVQFPVERSQDELTVETSLVKLTFDTTTGGLKTV--KMNGFTEN 573
            :.|.|....|||..|      :|...|    .::|:|.:.:||.| :::|.|:.:  |.:|.|..
 Frog   735 YTIFVQGKHKNINSDGNFRIKEVNIVV----GDVTIENTYLKLWF-SSSGLLEKIQSKEDGKTHG 794

  Fly   574 IQQTFGIYKGYRGNNGESKNR-SSGAYVFRPYGDIEIVNNK----VELSFYNGTKVKEV---HQH 630
            ::..|..|       |.:.|| .||||:|.|.|:.:...|.    |.::  :|:...||   .:|
 Frog   795 VKVDFIWY-------GTTNNRDKSGAYLFLPDGEAKPYINADPPVVRVT--HGSIFSEVVVFFKH 850

  Fly   631 VNEWISQVIRIYEDVNRVEFEWLVGPIPTDDDV-------GKEIITRFSSNISSKGKFYTDSNGR 688
                ::..:|:| :|:.:|     |..|...:|       .:||:.|.:|:|:||.:||||.||.
 Frog   851 ----LTHTVRLY-NVHGLE-----GQSPEITNVVDIRGEFNREIVMRITSDINSKHRFYTDLNGY 905

  Fly   689 EILERERNQREHFTPDMSE-AISGNYYPVTGQISLQDDEKRITLLNDRAQGGTSLKDGELELMLH 752
            :|..|.         .:|: .|..|.||:|....:|||..|:||.:.::.|..|.|.|:||:.|.
 Frog   906 QIQPRR---------TLSKLPIQANVYPMTSMAYIQDDASRLTLHSAQSLGVASSKSGQLEVFLD 961

  Fly   753 RRLLNDDAFGVGEALNETQYGTGLIARGKIYLILD---AVDGKPNQRLLQH-QLDQHFWKFF--- 810
            |||:.||..|:|:.:.:.:..:.|..     |:|:   ..|.|.:::.:.: .:..|....|   
 Frog   962 RRLMQDDNRGLGQGVQDNKITSNLFR-----LLLEKRFGKDEKEDEKPVSYPSILSHITSMFLNH 1021

  Fly   811 ------SKSNGVASVNRN-MIPDFFGIPESVELLSLE-------PYSKDQ--ILIRLENFN---- 855
                  :.|:..:||..| .:|....:|..|.||:|.       |...|:  :::..:.|:    
 Frog  1022 PVIPMAATSDSGSSVLLNAFLPLTSSMPCDVHLLNLRTIQAKVGPIPSDEAALILHRKGFDCKFS 1086

  Fly   856 ----------TEGNVVSFNIYPLFESLDGYQIWETTLDGNMLLEDVKRFKFAQDGTGSIPSSVEY 910
                      |:|.|   :::.||   :|:.|                       ...||||:..
 Frog  1087 NKDLGLLCSTTQGKV---SVHRLF---NGFNI-----------------------ESLIPSSLTL 1122

  Fly   911 YHAPHNPLTANSTMNASGFVVTLVPMQIRTFIIQ 944
            .|:..|  :.|:|      .:.:..|.|:||.|:
 Frog  1123 MHSSSN--SKNTT------EIRISTMDIKTFRIK 1148

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManINP_001260350.1 GH38N_AMII_LAM_like 2..276 CDD:212121 100/298 (34%)
Alpha-mann_mid 323..398 CDD:286360 29/86 (34%)
Glyco_hydro_38C 536..941 CDD:285047 115/460 (25%)
man2a1NP_001163963.1 PLN02701 130..1150 CDD:178304 294/1075 (27%)
CE4_SF 167..509 CDD:301698 116/357 (32%)
Alpha-mann_mid 504..590 CDD:214875 29/86 (34%)
Glyco_hydro_38C 755..1145 CDD:285047 116/465 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.