DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManI and man2b2

Sequence 1:NP_001260350.1 Gene:LManI FlyBaseID:FBgn0032253 Length:950 Species:Drosophila melanogaster
Sequence 2:XP_001337519.3 Gene:man2b2 ZFINID:ZDB-GENE-140106-166 Length:1006 Species:Danio rerio

Alignment Length:1058 Identity:270/1059 (25%)
Similarity:460/1059 (43%) Gaps:192/1059 (18%)


  Fly     2 INVHLVPHSHDDVGWLKTVDQYYYGSQNKIQHAGVQYILDTVVEELLKDSSRRFIQVETFFFAKW 66
            |...::||||.||||:.||.:        ..||....:..||||||.:..:|:||.||..||..|
Zfish    23 IQAFVIPHSHMDVGWVYTVQE--------SMHAYASNVYSTVVEELTRVKNRKFIAVEQEFFRLW 79

  Fly    67 YSE-QTETVQRAVKKLVAQGRLEFAGGAWSMNDEATVHYQSVVDQFNLGLRYLKDTFGDCGRPTV 130
            ::. .::..::.|::|:.:|||||..|...|:|||.......:.|...|..:|.:|||  .||..
Zfish    80 WTNVASDWHKKQVRQLLLEGRLEFIIGGQVMHDEAVTDVDDAILQLTEGHGFLYETFG--VRPRF 142

  Fly   131 GWQIDPFGHSREMASIFAQMAFNGEFFARMDYVDKKQRMLDLEMEMIWQSSESLK-NSNIFTGML 194
            .|.:||||.|.....:||...|:....:|:||..|.....:.:::.:|:.|.:|| ...|||..:
Zfish   143 AWHVDPFGASATTPVLFALAGFDAHLISRIDYDLKDDMQKNKKLQFVWRGSPTLKEKQEIFTHTM 207

  Fly   195 ---------YNHYSAPPGFCFD-INCEDAPIIDGESYDN--------NVDARVSEFIDYVKNMSK 241
                     |..:|...||.:: :.....|..||: |.|        .|:......:|.::..::
Zfish   208 DQFSYCTPSYIPFSNRSGFYWNGVALFPDPPKDGK-YPNMSLPVTKETVELYAQTMVDNIRLRAQ 271

  Fly   242 SYRSTHIMVPMGDDFQYEDAAVNFKNMDKLIKYVNDRQSTGSQVNVFYSTPSCYLYELHQLKQTW 306
            .:||:|::.|.|.|.|:.:|:|.|.|||.|:.|:| ..|....|.|.|:|...|...|||...:|
Zfish   272 WFRSSHVLWPWGCDKQFYNASVQFSNMDVLMNYIN-THSDQYGVTVQYATLKDYFQTLHQTNLSW 335

  Fly   307 PNK-TEDFFPYSSDSHSYWTGYFTSRPTQKRFHRDGNHFFQTVKQLSVLANLS---GTQYSE--- 364
            ..: .:||.|||::....|||::.||...|...|..:......:.|....::|   |....|   
Zfish   336 DVRGNQDFLPYSTEPFQAWTGFYGSRNVLKGVARRASSLLYASESLFTRYHISYPDGPVQREWAL 400

  Fly   365 -DLDNLSQAMGIMQHHDAVTGTEKQAVASDYDRLLFKAIVGAE--------------NSARDALR 414
             .|..|..|:..:||||.:||||...||..|...|.:.::|||              |...|.::
Zfish   401 SKLKALRWAVSEVQHHDGITGTESPKVADMYMEHLLQGMMGAEELLAAIFLLPQTLSNDIYDQIK 465

  Fly   415 SLTNLTSGEFESCLELNISVCAFTQDTANNVIVTLVNPLAHSSTQYVRVPAKNENYIVTDEKGRE 479
            :.......:.|:..|.:|.|               .||||.:.:.||.|..:....:|.|:.|:.
Zfish   466 NTPTTARTDSENVPEQHIFV---------------YNPLAWNISTYVNVSVQYAMAVVLDDDGKA 515

  Fly   480 VFSEVVPVPWQVLALEHRPNDTQHELVFEASVD--KIANFLIRVLPSP---------KNIA---- 529
            |.:::.|      ::|   :.|.::|.|...:.  :...:.::...||         .::|    
Zfish   516 VPAQIQP------SME---SSTVYDLFFVVELGGLQYRKYTVQFPQSPCDTGSACGATHVAKVVK 571

  Fly   530 --EDQVQFPVERSQDELTVETSLVKLTFDTTTGGLKTV--KMNGFTENIQQTFGIYKGYRGNNGE 590
              :..|:...:..:..|.|.....||.||..|..|.::  :.......:||.|..||.    ||:
Zfish   572 FNKTNVRQWKKTGRKLLPVLNECYKLMFDQETNLLHSITDRSKKIRVRVQQDFWEYKA----NGD 632

  Fly   591 SKNRS-SGAYVFRPYGDIEIVNNKVELSFYNGTKVKEVHQH-------VNEWISQVIRIYEDVN- 646
            .::.. |..|:|...|........|.:....|..:.|:.|:       .|...|.|.|:..... 
Zfish   633 VQSGPISDNYIFTANGSAVPAYKSVVMEIVPGKVISEIRQYFYREEEDANHTYSVVTRVPVGFKG 697

  Fly   647 -----RVEFEWLVGPIPTDDDVGKEIITRFSSNISSKGKFYTDSNGREILERERNQREHFTPDMS 706
                 |:|..:.|||:    :|.:|.:.|..:::.:....:||:||.::::|.      :....:
Zfish   698 RLSCFRLEQSYKVGPL----EVNRETVFRTRTSLQNNRTLFTDNNGYQMMKRT------YKGYAN 752

  Fly   707 EAISGNYYPVTGQISLQDDEKRITLLNDRAQGGTSLKDGELELMLHRRLLNDDAF--GVGEALNE 769
            ..::.||||:.....::|:..|:..|::||.|..||..|:||:||||||.|:..:  |....||:
Zfish   753 NTVARNYYPMVRVAYMEDESSRVVFLSERAHGVASLSQGQLEVMLHRRLWNNQEWNQGYNLTLND 817

  Fly   770 TQYGTGLIARGKIYLILDAVDG-----KPNQRLLQHQ-----LDQHFWKFFSKSNGVASVNRNMI 824
            :.     :.|..::::|.:.|.     :.....|||:     :||. .|..::....:..:.:.:
Zfish   818 SS-----VVRPVLWMMLGSPDSLSSIYQQEAVELQHRPVVMAIDQP-QKLLNQRETFSGPSVHPV 876

  Fly   825 PDFFGIPESVELLSLE----PYSK--------------DQILIRLENFNTEGN--VVS----FNI 865
            .    :|:::.:.||.    .||.              |:||:|:.:...||.  |:|    .|:
Zfish   877 V----LPQNLHMQSLSIPGWNYSPEHSSGGDEKSEVNFDRILLRITHLYEEGESPVLSQPTTINL 937

  Fly   866 YPLFESLDGY-QIWETTLDGNMLLEDVKRFKFAQDGTGSIPSSVEYYHAPHNPLTANSTMNASG- 928
            ..:.:.:... ::.|.:|.|...:.|::|:.:..|.|                :........|| 
Zfish   938 KEVMQGIGKVSKVQECSLTGTWNISDLQRWNWKTDET----------------MQKTDKSGFSGV 986

  Fly   929 ---FVVTLVPMQIRTFII 943
               |.||:.|.:||||.|
Zfish   987 TQDFNVTISPKEIRTFFI 1004

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManINP_001260350.1 GH38N_AMII_LAM_like 2..276 CDD:212121 93/294 (32%)
Alpha-mann_mid 323..398 CDD:286360 25/82 (30%)
Glyco_hydro_38C 536..941 CDD:285047 104/462 (23%)
man2b2XP_001337519.3 PLN02701 20..1002 CDD:178304 268/1055 (25%)
GH38-57_N_LamB_YdjC_SF 23..348 CDD:330225 109/337 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11607
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.