DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIB and Brf2

DIOPT Version :10

Sequence 1:NP_476888.1 Gene:TfIIB / 34430 FlyBaseID:FBgn0004915 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_079962.1 Gene:Brf2 / 66653 MGIID:1913903 Length:420 Species:Mus musculus


Alignment Length:300 Identity:63/300 - (21%)
Similarity:108/300 - (36%) Gaps:67/300 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SPLIED--YRAGDMICSECGLVVGDRVIDVGSEWRTFSNEKSGVDPSRVGGPENPLLSGGDLSTI 82
            |.|:||  |....::||:||.||.:.|:..     |||:|                  |......
Mouse    13 SELVEDSHYSQSQLVCSDCGCVVTEGVLTT-----TFSDE------------------GNFREVT 54

  Fly    83 IGPGTGSASFDAFGAPKYQNRRTMSSSDRSLISAFKEISSMADRINLPKTIVDRANNLFKQVHDG 147
            ....||            :|.:......|.|    :.:..:...:.||.|..|.|.:.:::.:..
Mouse    55 YSRSTG------------ENEQVSRCQQRDL----RRVRDLCRILKLPLTFEDTAISYYQKAYQL 103

  Fly   148 KNLKG---RSNDAKASACLYIACRQEGVPRTFKEICAVSKISKKEIGRCFKLTLKALETSVDLIT 209
            ..::.   :..:.....|:.|.|||...|.|...||.:...........:...:|.|...|..:.
Mouse   104 SGIRAARLQKKEVLVGCCVLITCRQHNWPLTMGTICTLLYADLDLFSGTYMQMVKLLGLDVPSLC 168

  Fly   210 TADFMCRFCANL---------------DLPNMVQRAATHIAKKAVEMDIVPGRSPISVAAAAIYM 259
            .||.:..:|::.               |...|:.|... :.:.|.|..:|.||.|:.:..||.::
Mouse   169 LADLVKSYCSSFKLFQASPSVPAKYVEDKDKMLSRTLL-LVELADETWLVTGRHPLPIITAATFL 232

  Fly   260 ASQA-SEHKRSQKEIGDIAGVADVTIRQSYKLMYPHAAKL 298
            |.|: ....|....:.....:|:|      .|.||.|::|
Mouse   233 AWQSLRPSDRLTCSLAQFCKLANV------DLPYPAASRL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIBNP_476888.1 SUA7 1..289 CDD:441015 58/289 (20%)
Brf2NP_079962.1 SUA7 5..233 CDD:441015 53/259 (20%)
CYCLIN_BRF2 66..162 CDD:410258 18/99 (18%)
Repetitive region 72..157 15/88 (17%)
Interaction with target DNA. /evidence=ECO:0000250|UniProtKB:Q9HAW0 108..114 0/5 (0%)
Repetitive region 173..249 15/76 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 316..387
Required for the formation of a ternary complex with DNA and TBP, not required for interaction with TBP in the absence of DNA. /evidence=ECO:0000250|UniProtKB:Q9HAW0 358..364
Required for interaction with TBP and formation of a ternary complex with DNA and TBP. /evidence=ECO:0000250|UniProtKB:Q9HAW0 366..420
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.