DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdfy2 and TEX1

DIOPT Version :9

Sequence 1:NP_001188779.1 Gene:Wdfy2 / 34425 FlyBaseID:FBgn0032246 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_014146.1 Gene:TEX1 / 855468 SGDID:S000005197 Length:422 Species:Saccharomyces cerevisiae


Alignment Length:255 Identity:49/255 - (19%)
Similarity:99/255 - (38%) Gaps:38/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DKTVRVWLKRDSG------QYWPSIC---------QYMPSGCTAIEYVSESRHLYVGQENGTVTQ 102
            |.::.||..:|:.      .|.|..|         .:.|:....|..||.|         ..::.
Yeast    84 DGSLTVWFIKDASFDKSVEVYIPDCCGSDKLATDLSWNPTSLNQIAVVSNS---------SEISL 139

  Fly   103 YALSEDCNRLSFLRDY-LSHQARVMAVVFSKTHKWILSAGK-DKQFAYHCTESGKRVGGYNF--- 162
            ..::|.....|.||.. |..:.:|...::.....|:|:|.| :|.:.:...:....|...|.   
Yeast   140 LLINEKSLTASKLRTLSLGSKTKVNTCLYDPLGNWLLAATKSEKIYLFDVKKDHSSVCSLNISDI 204

  Fly   163 ----ETPCTALQFDALAKYAFVGDHAGQITMLRCDVQGVQLITTFNGHSAEIRCLKWVEGPQLLF 223
                .....:|.:.....:.|:|..:|.:.:|:.....:::.|....|:..|..:|.....:...
Yeast   205 SQEDNDVVYSLAWSNGGSHIFIGFKSGYLAILKAKHGILEVCTKIKAHTGPITEIKMDPWGRNFI 269

  Fly   224 SGACDQSVLVWDVGGKRGTIYEL--QGHSNKVSALSYANHTQQLISCGEDSVVVFWEMNA 281
            :|:.|.:..||::   :....||  ...::.|:.|...:..:.|..|.||.:|.|:::|:
Yeast   270 TGSIDGNCYVWNM---KSLCCELIINDLNSAVTTLDVCHLGKILGICTEDEMVYFYDLNS 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdfy2NP_001188779.1 WD40 4..405 CDD:225201 49/255 (19%)
WD40 24..279 CDD:295369 48/251 (19%)
WD40 repeat 35..72 CDD:293791 6/24 (25%)
WD40 repeat 80..117 CDD:293791 7/36 (19%)
WD40 repeat 125..161 CDD:293791 7/36 (19%)
WD40 repeat 166..205 CDD:293791 6/38 (16%)
WD40 repeat 211..248 CDD:293791 7/38 (18%)
WD40 repeat 253..283 CDD:293791 9/29 (31%)
FYVE_WDFY1_like 287..356 CDD:277258
WD40 repeat 324..371 CDD:293791
TEX1NP_014146.1 WD40 1..>374 CDD:225201 49/255 (19%)
WD40 repeat 66..109 CDD:293791 6/24 (25%)
WD40 repeat 116..158 CDD:293791 9/50 (18%)
WD40 repeat 163..205 CDD:293791 8/41 (20%)
WD40 repeat 213..249 CDD:293791 6/35 (17%)
WD40 repeat 256..290 CDD:293791 7/36 (19%)
WD40 repeat 298..336 CDD:293791 9/29 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002613
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.