| Sequence 1: | NP_001188779.1 | Gene: | Wdfy2 / 34425 | FlyBaseID: | FBgn0032246 | Length: | 408 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_014146.1 | Gene: | TEX1 / 855468 | SGDID: | S000005197 | Length: | 422 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 255 | Identity: | 49/255 - (19%) |
|---|---|---|---|
| Similarity: | 99/255 - (38%) | Gaps: | 38/255 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 53 DKTVRVWLKRDSG------QYWPSIC---------QYMPSGCTAIEYVSESRHLYVGQENGTVTQ 102
Fly 103 YALSEDCNRLSFLRDY-LSHQARVMAVVFSKTHKWILSAGK-DKQFAYHCTESGKRVGGYNF--- 162
Fly 163 ----ETPCTALQFDALAKYAFVGDHAGQITMLRCDVQGVQLITTFNGHSAEIRCLKWVEGPQLLF 223
Fly 224 SGACDQSVLVWDVGGKRGTIYEL--QGHSNKVSALSYANHTQQLISCGEDSVVVFWEMNA 281 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Wdfy2 | NP_001188779.1 | WD40 | 4..405 | CDD:225201 | 49/255 (19%) |
| WD40 | 24..279 | CDD:295369 | 48/251 (19%) | ||
| WD40 repeat | 35..72 | CDD:293791 | 6/24 (25%) | ||
| WD40 repeat | 80..117 | CDD:293791 | 7/36 (19%) | ||
| WD40 repeat | 125..161 | CDD:293791 | 7/36 (19%) | ||
| WD40 repeat | 166..205 | CDD:293791 | 6/38 (16%) | ||
| WD40 repeat | 211..248 | CDD:293791 | 7/38 (18%) | ||
| WD40 repeat | 253..283 | CDD:293791 | 9/29 (31%) | ||
| FYVE_WDFY1_like | 287..356 | CDD:277258 | |||
| WD40 repeat | 324..371 | CDD:293791 | |||
| TEX1 | NP_014146.1 | WD40 | 1..>374 | CDD:225201 | 49/255 (19%) |
| WD40 repeat | 66..109 | CDD:293791 | 6/24 (25%) | ||
| WD40 repeat | 116..158 | CDD:293791 | 9/50 (18%) | ||
| WD40 repeat | 163..205 | CDD:293791 | 8/41 (20%) | ||
| WD40 repeat | 213..249 | CDD:293791 | 6/35 (17%) | ||
| WD40 repeat | 256..290 | CDD:293791 | 7/36 (19%) | ||
| WD40 repeat | 298..336 | CDD:293791 | 9/29 (31%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0002613 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||