DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdfy2 and PWP2

DIOPT Version :9

Sequence 1:NP_001188779.1 Gene:Wdfy2 / 34425 FlyBaseID:FBgn0032246 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_172998.1 Gene:PWP2 / 838115 AraportID:AT1G15440 Length:900 Species:Arabidopsis thaliana


Alignment Length:289 Identity:62/289 - (21%)
Similarity:108/289 - (37%) Gaps:76/289 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QRTNNDRFNTSKKPELL----------SKLEGSSDDVNAAILIPGENGVISVSDDKTVRVWLKRD 63
            :|.|...|..:|..:||          .|.:|...|||.....|....:.:.:||..|:|| ...
plant   356 ERGNWLTFGCAKLGQLLVWDWRTETYILKQQGHYFDVNCVTYSPDSQLLATGADDNKVKVW-NVM 419

  Fly    64 SGQYWPSICQYMPSGCTAIEYVSESRHLYVGQENGTVTQYALSEDCNRLSFLRDYLSHQARVMAV 128
            ||..:.:..:: .:..||:.:::::..|.....:|||..:             |:          
plant   420 SGTCFITFTEH-TNAVTALHFMADNHSLLSASLDGTVRAW-------------DF---------- 460

  Fly   129 VFSKTHKWILSAGKDKQFAYHCTESGKRVGGYNFETPCTALQFDALAKYAFVGDHAGQI----TM 189
                                      ||...|...|..|..||.:|     ..|.:|.:    |:
plant   461 --------------------------KRYKNYKTYTTPTPRQFVSL-----TADPSGDVVCAGTL 494

  Fly   190 LRCDV-----QGVQLITTFNGHSAEIRCLKWVEGPQLLFSGACDQSVLVWDVGGKRGTIYELQGH 249
            ...::     :..|:....:||.|.:..|.:....|||.|.:.|.:|.:|||...:||: |...|
plant   495 DSFEIFVWSKKTGQIKDILSGHEAPVHGLMFSPLTQLLASSSWDYTVRLWDVFASKGTV-ETFRH 558

  Fly   250 SNKVSALSYANHTQQLISCGEDSVVVFWE 278
            ::.|..:::....:||.|...|..:.||:
plant   559 NHDVLTVAFRPDGKQLASSTLDGQINFWD 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdfy2NP_001188779.1 WD40 4..405 CDD:225201 62/289 (21%)
WD40 24..279 CDD:295369 58/274 (21%)
WD40 repeat 35..72 CDD:293791 10/36 (28%)
WD40 repeat 80..117 CDD:293791 6/36 (17%)
WD40 repeat 125..161 CDD:293791 2/35 (6%)
WD40 repeat 166..205 CDD:293791 8/47 (17%)
WD40 repeat 211..248 CDD:293791 13/36 (36%)
WD40 repeat 253..283 CDD:293791 7/26 (27%)
FYVE_WDFY1_like 287..356 CDD:277258
WD40 repeat 324..371 CDD:293791
PWP2NP_172998.1 WD40 repeat 55..92 CDD:293791
WD40 93..459 CDD:392136 25/117 (21%)
WD40 repeat 96..139 CDD:293791
WD40 repeat 145..185 CDD:293791
WD40 repeat 190..298 CDD:293791
WD40 repeat 307..344 CDD:293791
WD40 338..599 CDD:238121 62/289 (21%)
WD40 repeat 393..429 CDD:293791 9/36 (25%)
WD40 repeat 434..470 CDD:293791 10/84 (12%)
WD40 repeat 478..514 CDD:293791 5/40 (13%)
WD40 repeat 520..557 CDD:293791 13/37 (35%)
Utp12 790..895 CDD:367767
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.