DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdfy2 and TBL1XR1

DIOPT Version :9

Sequence 1:NP_001188779.1 Gene:Wdfy2 / 34425 FlyBaseID:FBgn0032246 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001308122.1 Gene:TBL1XR1 / 79718 HGNCID:29529 Length:514 Species:Homo sapiens


Alignment Length:365 Identity:82/365 - (22%)
Similarity:133/365 - (36%) Gaps:85/365 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LEGSSDDVNAAILIPGENGVISVSDDKTVRVW--------------LK---RDSGQYWPSICQYM 75
            |.|...:|......|..:.:.|.|.|.|.|:|              |:   |:.||..||     
Human   165 LRGHESEVFICAWNPVSDLLASGSGDSTARIWNLSENSTSGSTQLVLRHCIREGGQDVPS----- 224

  Fly    76 PSGCTAIEYVSESRHLYVGQENGTVTQYALSEDCNRLSFLRDYLSHQARVMAVVFSKTHKWILSA 140
            ....|::::.||...|..|..:|....:  ::|.|..|.|.   .|:..:.|:.::|...:||||
Human   225 NKDVTSLDWNSEGTLLATGSYDGFARIW--TKDGNLASTLG---QHKGPIFALKWNKKGNFILSA 284

  Fly   141 GKDKQFAYHCTESGKRVGGYNFETPCTALQFDALAKYAFVGDHAGQITMLRCDVQGVQLITTFNG 205
            |.||........:|:....:.|.: ..||..|..:...|..........: |.:...:.|.||.|
Human   285 GVDKTTIIWDAHTGEAKQQFPFHS-APALDVDWQSNNTFASCSTDMCIHV-CKLGQDRPIKTFQG 347

  Fly   206 HSAEIRCLKWVEGPQLLFSGACDQSVLVWDVGGKRGTIYELQGHSNKVSALSYA---------NH 261
            |:.|:..:||.....||.|.:.|.::.:|.: .:...:::||.|:.::..:.::         |.
Human   348 HTNEVNAIKWDPTGNLLASCSDDMTLKIWSM-KQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNA 411

  Fly   262 TQQLISCGEDSVVVFWEMNAMRKEVPGWVDTNNC---------------------QLCSRPF--- 302
            ...|.|...||.|..|:           ||...|                     .|.|..|   
Human   412 NLMLASASFDSTVRLWD-----------VDRGICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKC 465

  Fly   303 --FWNFRSMMDQKQLGIRQHHCRHCGK--AVCDNCSTNRI 338
              .||       .|.|...|..|..|.  .||.|.:.:::
Human   466 VHIWN-------TQTGALVHSYRGTGGIFEVCWNAAGDKV 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdfy2NP_001188779.1 WD40 4..405 CDD:225201 82/365 (22%)
WD40 24..279 CDD:295369 66/276 (24%)
WD40 repeat 35..72 CDD:293791 14/53 (26%)
WD40 repeat 80..117 CDD:293791 10/36 (28%)
WD40 repeat 125..161 CDD:293791 10/35 (29%)
WD40 repeat 166..205 CDD:293791 8/38 (21%)
WD40 repeat 211..248 CDD:293791 8/36 (22%)
WD40 repeat 253..283 CDD:293791 7/38 (18%)
FYVE_WDFY1_like 287..356 CDD:277258 16/80 (20%)
WD40 repeat 324..371 CDD:293791 4/17 (24%)
TBL1XR1NP_001308122.1 LisH 7..31 CDD:369916
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..139
WD40 164..470 CDD:238121 72/328 (22%)
WD 1 167..206 9/38 (24%)
WD40 repeat 172..215 CDD:293791 9/42 (21%)
WD 2 223..262 11/45 (24%)
WD40 repeat 228..264 CDD:293791 10/40 (25%)
WD 3 264..303 11/38 (29%)
WD40 repeat 270..306 CDD:293791 10/35 (29%)
WD 4 306..344 7/39 (18%)
WD40 repeat 311..346 CDD:293791 7/35 (20%)
WD 5 347..386 10/39 (26%)
WD40 repeat 353..388 CDD:293791 7/35 (20%)
WD 6 389..437 11/58 (19%)
WD40 repeat 394..439 CDD:293791 10/55 (18%)
WD 7 440..479 7/45 (16%)
WD40 repeat 445..483 CDD:293791 9/44 (20%)
WD 8 481..513 5/18 (28%)
WD40 repeat 486..509 CDD:293791 3/13 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.