powered by:
Protein Alignment Wdfy2 and fbxa-169
DIOPT Version :9
| Sequence 1: | NP_001188779.1 |
Gene: | Wdfy2 / 34425 |
FlyBaseID: | FBgn0032246 |
Length: | 408 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001364654.1 |
Gene: | fbxa-169 / 6418621 |
WormBaseID: | WBGene00045289 |
Length: | 302 |
Species: | Caenorhabditis elegans |
| Alignment Length: | 34 |
Identity: | 11/34 - (32%) |
| Similarity: | 17/34 - (50%) |
Gaps: | 2/34 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 345 FEFDVRTCDPCYKQLQTVERPSLAS--FNDAKHS 376
|:..::..|...|.|..:||.:|.: ||..|.|
Worm 75 FDLPLQIHDKILKNLNVLERLNLRNVCFNFRKIS 108
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG1409 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.