DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Wdfy2 and stam2

DIOPT Version :9

Sequence 1:	NP_001188779.1	Gene:	Wdfy2 / 34425	FlyBaseID:	FBgn0032246	Length:	408	Species:	Drosophila melanogaster
Sequence 2:	NP_001007370.2	Gene:	stam2 / 492497	ZFINID:	ZDB-GENE-041114-64	Length:	509	Species:	Danio rerio

Alignment Length:	120	Identity:	25/120 - (20%)
Similarity:	43/120 - (35%)	Gaps:	30/120 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 PAQRTNNDRFNTSKKPELLSKLEGSSDDVNAAILIPGENGVISVSDDKTVRVWLKRDSGQ---YW 68
            |...||..:  .|:|...|...|.:.|  |......||  ::.:.||.... |.|.::.:   .:
Zfish   195 PPYNTNGGK--ESRKVRALYDFEAAED--NELTFKAGE--LVIILDDSDPN-WWKGENHRGVGLF 252

  Fly    69 PSICQYMPSGCTA------------------IEYVSESRHLYVGQENGTVTQYAL 105
            ||  .::.:...|                  :|..:|...:|:.:|....|.|.|
Zfish   253 PS--NFVTTNLNAEPDPVMYVEKTVVPEEPIVEVKAEPEPVYIDEEKMDKTLYLL 305

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Wdfy2	NP_001188779.1	WD40	4..405	CDD:225201	25/120 (21%)
		WD40	24..279	CDD:295369	20/103 (19%)
		WD40 repeat	35..72	CDD:293791	9/39 (23%)
		WD40 repeat	80..117	CDD:293791	8/44 (18%)
		WD40 repeat	125..161	CDD:293791
		WD40 repeat	166..205	CDD:293791
		WD40 repeat	211..248	CDD:293791
		WD40 repeat	253..283	CDD:293791
		FYVE_WDFY1_like	287..356	CDD:277258
		WD40 repeat	324..371	CDD:293791
stam2	NP_001007370.2	VHS_STAM	9..147	CDD:239625
		SH3_STAM	206..259	CDD:212754	13/59 (22%)
		GAT	295..368	CDD:281166	4/11 (36%)
		Forkhead_N	366..479	CDD:254796
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170574125
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.930