| Sequence 1: | NP_001188779.1 | Gene: | Wdfy2 / 34425 | FlyBaseID: | FBgn0032246 | Length: | 408 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_997656.1 | Gene: | Wdr46 / 309628 | RGDID: | 2209 | Length: | 609 | Species: | Rattus norvegicus |
| Alignment Length: | 337 | Identity: | 72/337 - (21%) |
|---|---|---|---|
| Similarity: | 111/337 - (32%) | Gaps: | 98/337 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 15 RFNTSK-----KPELLSKL--------EGSSDDVNAAILIPGENGVISVSDDKTVRVWLKRD--- 63
Fly 64 -------SGQYWPSICQYMPSGCTAIEYVSESRHLYVGQENG------TVTQYALSEDCNRLSFL 115
Fly 116 RD-YLSHQARVMAVVFSKTHKWILSAGKDKQ-FAYHCTESGKRVGGYNFETPCTALQFDALAKYA 178
Fly 179 FVGDHAGQITMLRCDVQGVQLITTFN--------------------GHS---------------A 208
Fly 209 EIRCLKW--------VEGPQLLFSGACDQSVLVWDVGGKRGTIYELQGHSNKVSALSYANHTQQL 265
Fly 266 ISCGEDSVVVFW 277 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Wdfy2 | NP_001188779.1 | WD40 | 4..405 | CDD:225201 | 72/337 (21%) |
| WD40 | 24..279 | CDD:295369 | 67/323 (21%) | ||
| WD40 repeat | 35..72 | CDD:293791 | 7/46 (15%) | ||
| WD40 repeat | 80..117 | CDD:293791 | 10/42 (24%) | ||
| WD40 repeat | 125..161 | CDD:293791 | 9/36 (25%) | ||
| WD40 repeat | 166..205 | CDD:293791 | 10/58 (17%) | ||
| WD40 repeat | 211..248 | CDD:293791 | 10/44 (23%) | ||
| WD40 repeat | 253..283 | CDD:293791 | 7/25 (28%) | ||
| FYVE_WDFY1_like | 287..356 | CDD:277258 | |||
| WD40 repeat | 324..371 | CDD:293791 | |||
| Wdr46 | NP_997656.1 | Rubella_Capsid | 5..>75 | CDD:283420 | |
| WD40 repeat | 198..234 | CDD:293791 | 9/36 (25%) | ||
| WD40 | <202..389 | CDD:225201 | 43/207 (21%) | ||
| WD40 | <207..386 | CDD:295369 | 41/196 (21%) | ||
| WD40 repeat | 239..273 | CDD:293791 | 10/38 (26%) | ||
| WD40 repeat | 277..313 | CDD:293791 | 10/46 (22%) | ||
| WD40 repeat | 320..355 | CDD:293791 | 4/34 (12%) | ||
| WD40 | 354..>447 | CDD:295369 | 18/76 (24%) | ||
| WD40 repeat | 361..398 | CDD:293791 | 9/40 (23%) | ||
| WD40 repeat | 406..442 | CDD:293791 | 6/20 (30%) | ||
| BING4CT | 439..517 | CDD:198101 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||