DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdfy2 and Plekhf1

DIOPT Version :9

Sequence 1:NP_001188779.1 Gene:Wdfy2 / 34425 FlyBaseID:FBgn0032246 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001013166.1 Gene:Plekhf1 / 308543 RGDID:1310544 Length:279 Species:Rattus norvegicus


Alignment Length:161 Identity:38/161 - (23%)
Similarity:61/161 - (37%) Gaps:43/161 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 VSALS------YANHTQ-----QLISCGEDSVVVFWEMNAMRKEVPGWVDTNNCQLCSRPFFWNF 306
            |||.|      :.:|.:     ||::.|.....         :....|:......:|.|.....|
  Rat   111 VSAASTTERQEWISHIEECVRRQLLATGRQPTT---------EHAAPWIPDKATDICMRCTQTRF 166

  Fly   307 RSMMDQKQLGIRQHHCRHCGKAVCDNCSTNRINIPIMGFEFDVRTCDPCYKQLQTVERPSLAS-- 369
            .::       .|:||||.||..||..||..|..:|.:..: .:|.|..||::|...:|...|.  
  Rat   167 SAL-------TRRHHCRKCGFVVCAECSRERFLLPRLSPK-PLRVCSLCYRELAAQKRREEAKER 223

  Fly   370 FNDAKHSIVYM-------------DLDEDRK 387
            |..:...:.::             |.||||:
  Rat   224 FRGSPGQLTHLGSTMCGASSGDDDDSDEDRE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdfy2NP_001188779.1 WD40 4..405 CDD:225201 38/161 (24%)
WD40 24..279 CDD:295369 8/36 (22%)
WD40 repeat 35..72 CDD:293791
WD40 repeat 80..117 CDD:293791
WD40 repeat 125..161 CDD:293791
WD40 repeat 166..205 CDD:293791
WD40 repeat 211..248 CDD:293791
WD40 repeat 253..283 CDD:293791 8/40 (20%)
FYVE_WDFY1_like 287..356 CDD:277258 19/68 (28%)
WD40 repeat 324..371 CDD:293791 15/48 (31%)
Plekhf1NP_001013166.1 PH_Phafin2-like 7..129 CDD:269927 5/17 (29%)
PH 39..131 CDD:278594 5/19 (26%)
FYVE_PKHF1 148..211 CDD:277293 21/70 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..264 7/36 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.