DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdfy2 and taf5

DIOPT Version :9

Sequence 1:NP_001188779.1 Gene:Wdfy2 / 34425 FlyBaseID:FBgn0032246 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_587902.1 Gene:taf5 / 2539353 PomBaseID:SPCC5E4.03c Length:643 Species:Schizosaccharomyces pombe


Alignment Length:296 Identity:65/296 - (21%)
Similarity:123/296 - (41%) Gaps:30/296 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NDRFNTSKKPELLSKL----EGSSDDVNAA--ILIPGENGVISVSDDKTVRVWLKR---DSGQYW 68
            ||..|.|  |:||.:.    |.:::|..:.  |.:|...||..:|:.:.|:.|.||   ......
pombe   250 NDPNNQS--PKLLKEFRKLHEPNAEDAPSRDYIPLPPHKGVDILSEVEAVKDWSKRLHLGPRASL 312

  Fly    69 PSICQY----MPSGCTAIEYVSESRHLYVGQENGTVTQYALSEDCNRL---SFLRD------YLS 120
            ||:|.|    ..:.....|:..:|..:..|.:...:..:::..|...|   :.:.|      .||
pombe   313 PSVCMYTFHHTNNNMNCAEFSPDSTMIACGFQESYIRLWSIKADKKSLPKSTSVEDSDGSVRLLS 377

  Fly   121 HQARVMAVVFSKTHKWILSAGKDKQFAYHCTESGKRVGGYNFET-PCTALQFDALAKYAFVGDHA 184
            |...|....||..:|::||..:|........::...:..|...| |...:.|.....|.....|.
pombe   378 HSGPVYGTTFSPDNKYLLSCSEDASARLWSVDTKTALVAYKGHTGPVWDVAFGPFGHYFATASHD 442

  Fly   185 GQITMLRCDVQGVQLITTFNGHSAEIRCLKWVEGPQLLFSGACDQSVLVWDVGGKRG-TIYELQG 248
            ....:..||  .:..:..|.||.:::.|:.:......:.:|:.|::..:|||  .|| ::....|
pombe   443 QTAQLWSCD--HIYPLRVFAGHLSDVDCVTFHPNSAYVLTGSSDKTCRLWDV--HRGHSVRVFNG 503

  Fly   249 HSNKVSALSYANHTQQLISCGEDSVVVFWEMNAMRK 284
            |:..|:|::.|.....:.|...:.::..|::...|:
pombe   504 HTQPVTAVAIAPDGHTMASADSEGLIHLWDIGTGRR 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdfy2NP_001188779.1 WD40 4..405 CDD:225201 65/296 (22%)
WD40 24..279 CDD:295369 59/278 (21%)
WD40 repeat 35..72 CDD:293791 11/41 (27%)
WD40 repeat 80..117 CDD:293791 5/39 (13%)
WD40 repeat 125..161 CDD:293791 7/35 (20%)
WD40 repeat 166..205 CDD:293791 6/38 (16%)
WD40 repeat 211..248 CDD:293791 8/37 (22%)
WD40 repeat 253..283 CDD:293791 5/29 (17%)
FYVE_WDFY1_like 287..356 CDD:277258
WD40 repeat 324..371 CDD:293791
taf5NP_587902.1 LisH 10..36 CDD:285685
TFIID_NTD2 54..177 CDD:282363
WD40 <316..588 CDD:225201 45/228 (20%)
WD40 repeat 329..377 CDD:293791 6/47 (13%)
WD40 <332..575 CDD:238121 42/212 (20%)
WD40 repeat 383..419 CDD:293791 7/35 (20%)
WD40 repeat 424..460 CDD:293791 5/37 (14%)
WD40 repeat 467..502 CDD:293791 8/36 (22%)
WD40 repeat 508..544 CDD:293791 6/32 (19%)
WD40 repeat 550..590 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.