DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdfy2 and KATNB1

DIOPT Version :9

Sequence 1:NP_001188779.1 Gene:Wdfy2 / 34425 FlyBaseID:FBgn0032246 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_005877.2 Gene:KATNB1 / 10300 HGNCID:6217 Length:655 Species:Homo sapiens


Alignment Length:188 Identity:43/188 - (22%)
Similarity:86/188 - (45%) Gaps:27/188 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LRDYLSHQARVMAVVFSKTHKWILSAGKDKQFAYHCTESGKRVGGYNFE------------TPCT 167
            |::.::|.:.|.::|..|....:|:.|.|     .|     ||..::..            :|..
Human    13 LQEIVAHASNVSSLVLGKASGRLLATGGD-----DC-----RVNLWSINKPNCIMSLTGHTSPVE 67

  Fly   168 ALQFDALAKYAFVGDHAGQITMLRCDVQGVQLITTFNGHSAEIRCLKWVEGPQLLFSGACDQSVL 232
            :::.:...:....|..:|.|.:  .|::..:::.|..||.|.|..|.:....:.:.||:.|.::.
Human    68 SVRLNTPEELIVAGSQSGSIRV--WDLEAAKILRTLMGHKANICSLDFHPYGEFVASGSQDTNIK 130

  Fly   233 VWDVGGKRGTIYELQGHSNKVSALSYANHTQQLISCGEDSVVVFWEMNA--MRKEVPG 288
            :||: .::|.::..:|||..|..|.::...:.|.|..:|..|..|::.|  |..|.||
Human   131 LWDI-RRKGCVFRYRGHSQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGKMMSEFPG 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdfy2NP_001188779.1 WD40 4..405 CDD:225201 43/188 (23%)
WD40 24..279 CDD:295369 38/175 (22%)
WD40 repeat 35..72 CDD:293791
WD40 repeat 80..117 CDD:293791 1/1 (100%)
WD40 repeat 125..161 CDD:293791 9/35 (26%)
WD40 repeat 166..205 CDD:293791 5/38 (13%)
WD40 repeat 211..248 CDD:293791 7/36 (19%)
WD40 repeat 253..283 CDD:293791 8/31 (26%)
FYVE_WDFY1_like 287..356 CDD:277258 2/2 (100%)
WD40 repeat 324..371 CDD:293791
KATNB1NP_005877.2 Interaction with centrosomes 1..300 43/188 (23%)
Interaction with dynein. /evidence=ECO:0000250 1..284 43/188 (23%)
WD40 7..257 CDD:238121 43/188 (23%)
WD40 repeat 67..103 CDD:293791 5/37 (14%)
WD40 repeat 108..144 CDD:293791 8/36 (22%)
WD40 repeat 151..186 CDD:293791 9/34 (26%)
WD40 repeat 192..228 CDD:293791
WD40 repeat 234..261 CDD:293791
Interaction with PAFAH1B1. /evidence=ECO:0000250 285..434
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..422
DNA_pol3_gamma3 <386..>494 CDD:331207
Interaction with KATNA1 and NDEL1. /evidence=ECO:0000250 433..655
Katanin_con80 497..648 CDD:316447
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.