DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and MDY2

DIOPT Version :9

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_014530.1 Gene:MDY2 / 854038 SGDID:S000005471 Length:212 Species:Saccharomyces cerevisiae


Alignment Length:78 Identity:21/78 - (26%)
Similarity:37/78 - (47%) Gaps:2/78 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TITLEVEPSDTIENVKAK-IQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI-QKESTLHLVLRLR 74
            :|..:..|||||..:|.. |.:::.....:.:|:..||.|.|...|||..: ...||:.::::..
Yeast    87 SIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPN 151

  Fly    75 GGAKKRKKKNYST 87
            ....|..:...||
Yeast   152 PTISKEPEAEKST 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 18/65 (28%)
Ribosomal_S27 103..147 CDD:396259
MDY2NP_014530.1 Get5_bdg 8..59 CDD:407090
Ubl_Rad23 74..148 CDD:340503 18/60 (30%)
Get5_C 174..212 CDD:408303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.