DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and MDY2

DIOPT Version :10

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_014530.1 Gene:MDY2 / 854038 SGDID:S000005471 Length:212 Species:Saccharomyces cerevisiae


Alignment Length:78 Identity:21/78 - (26%)
Similarity:37/78 - (47%) Gaps:2/78 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TITLEVEPSDTIENVKAK-IQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI-QKESTLHLVLRLR 74
            :|..:..|||||..:|.. |.:::.....:.:|:..||.|.|...|||..: ...||:.::::..
Yeast    87 SIEHDFSPSDTILQIKQHLISEEKASHISEIKLLLKGKVLHDNLFLSDLKVTPANSTITVMIKPN 151

  Fly    75 GGAKKRKKKNYST 87
            ....|..:...||
Yeast   152 PTISKEPEAEKST 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 18/65 (28%)
Ribosomal_S27 103..147 CDD:460261
MDY2NP_014530.1 Get5_bdg 8..59 CDD:407090
Ubl_Rad23 74..148 CDD:340503 18/60 (30%)
Get5_C 174..212 CDD:408303
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.