powered by:
Protein Alignment RpS27A and AT4G05270
DIOPT Version :9
Sequence 1: | NP_476778.1 |
Gene: | RpS27A / 34420 |
FlyBaseID: | FBgn0003942 |
Length: | 156 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_192436.1 |
Gene: | AT4G05270 / 825875 |
AraportID: | AT4G05270 |
Length: | 129 |
Species: | Arabidopsis thaliana |
Alignment Length: | 70 |
Identity: | 24/70 - (34%) |
Similarity: | 35/70 - (50%) |
Gaps: | 1/70 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAG-KQLEDGRTLSDYNIQKE 64
|:..|:.|.|.:..|||:..||:..||.||:..:.||..:|.||..| ..|.:..|:....|...
plant 1 MKFLVENLNGSSFELEVDYRDTLLVVKQKIERSQHIPVSKQTLIVDGIVILREDLTVEQCQIVPT 65
Fly 65 STLHL 69
|.:.|
plant 66 SDIQL 70
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.