DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and AT4G05240

DIOPT Version :9

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_192433.1 Gene:AT4G05240 / 825872 AraportID:AT4G05240 Length:197 Species:Arabidopsis thaliana


Alignment Length:47 Identity:15/47 - (31%)
Similarity:22/47 - (46%) Gaps:0/47 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTL 67
            ||:..:|.||:..:.|...:|.|.|.|..|:|...:....|...|.|
plant    78 DTVLEIKQKIEKYQRILVYRQTLFFQGNVLQDHLDIEQCVILNHSLL 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 15/47 (32%)
Ribosomal_S27 103..147 CDD:396259
AT4G05240NP_192433.1 Ubiquitin_like_fold 65..130 CDD:391949 15/47 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.