DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and AT4G05240

DIOPT Version :10

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_192433.1 Gene:AT4G05240 / 825872 AraportID:AT4G05240 Length:197 Species:Arabidopsis thaliana


Alignment Length:47 Identity:15/47 - (31%)
Similarity:22/47 - (46%) Gaps:0/47 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTL 67
            ||:..:|.||:..:.|...:|.|.|.|..|:|...:....|...|.|
plant    78 DTVLEIKQKIEKYQRILVYRQTLFFQGNVLQDHLDIEQCVILNHSLL 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 15/47 (32%)
Ribosomal_S27 103..147 CDD:460261
AT4G05240NP_192433.1 ubiquitin 65..130 CDD:459726 15/47 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.