DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and ubl7a

DIOPT Version :10

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001017765.2 Gene:ubl7a / 550462 ZFINID:ZDB-GENE-050417-285 Length:379 Species:Danio rerio


Alignment Length:104 Identity:32/104 - (30%)
Similarity:49/104 - (47%) Gaps:26/104 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EVEPSD---------TIEN-VKAKIQDKEGIP-PDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 69
            |.||.|         |::. |.|:|.|  .|| |:...|::.|::|:|..||..|.||..||:|:
Zfish    27 EAEPGDVPPGEYRVSTLKQLVSAQIPD--AIPDPELIELVYCGRKLKDDLTLESYGIQSGSTVHI 89

  Fly    70 VLRLRGGAKKRKKKNYSTPKKIKHKRKKVKLAVLKYYKV 108
            :         ||    |.|:...|.....|:|..:.::|
Zfish    90 L---------RK----SWPEPEIHPEPVDKVAAAREFRV 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 24/70 (34%)
Ribosomal_S27 103..147 CDD:460261 1/6 (17%)
ubl7aNP_001017765.2 Ubl_UBL7 7..98 CDD:340513 28/85 (33%)
UBA_UBL7 337..374 CDD:270511
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.