DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and Oas1e

DIOPT Version :9

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001009492.1 Gene:Oas1e / 494201 RGDID:1359611 Length:361 Species:Rattus norvegicus


Alignment Length:101 Identity:21/101 - (20%)
Similarity:49/101 - (48%) Gaps:11/101 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGA 77
            :..:|:|:   .:|..:::||:...||..|.|:| :.:.:..||   .::.|.::......:...
  Rat   146 VEFDVQPA---YDVLYELRDKDDFNPDNYREIYA-RLIRESTTL---EMEGEFSVCFTDLHQNFL 203

  Fly    78 KKRKKKNYSTPKKIKH----KRKKVKLAVLKYYKVD 109
            |.|..|.::..:.:||    .:|::|..:...|.::
  Rat   204 KYRAPKLWNIIRLVKHWYQLCKKRLKYPLPPQYALE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 13/62 (21%)
Ribosomal_S27 103..147 CDD:396259 1/7 (14%)
Oas1eNP_001009492.1 NT_2-5OAS_ClassI-CCAase 27..177 CDD:143390 10/34 (29%)
OAS1_C 167..351 CDD:287404 16/77 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.